[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56848.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:88 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->34 PF10032 * Pho88 0.0003 16.0 25/192  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56848.1 GT:GENE ABA56848.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 347161..347427 GB:FROM 347161 GB:TO 347427 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA56848.1 GB:DB_XREF GI:76882167 LENGTH 88 SQ:AASEQ MKQSFLPLGFSFSLRNPLFIASVMLPFAAWRGEVEAAEEYRDRLIPKTDSNPVVKVAQGDGAKEGGEAARSELAPMTVTGAADAPFTK GT:EXON 1|1-88:0| HM:PFM:NREP 1 HM:PFM:REP 10->34|PF10032|0.0003|16.0|25/192|Pho88| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 58-70, 87-88| PSIPRED ccccccccccEEcccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccEEEEEccccccccHHHHHHHcccEEEEccccccccc //