[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56887.1
DDBJ      :             metal-dependent protease of the PAD1/JAB1 superfamily
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.97.3
:134 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->109 2kksA PDBj 2e-12 35.2 %
:HMM:SCOP  1->132 1oi0A_ c.97.3.1 * 1.3e-26 40.5 %
:HMM:PFM   59->97 PF01398 * Mov34 1.6e-07 28.9 38/116  
:BLT:SWISS 4->129 Y1369_MYCBO 7e-09 28.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56887.1 GT:GENE ABA56887.1 GT:PRODUCT metal-dependent protease of the PAD1/JAB1 superfamily GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(395480..395884) GB:FROM 395480 GB:TO 395884 GB:DIRECTION - GB:PRODUCT metal-dependent protease of the PAD1/JAB1 superfamily GB:PROTEIN_ID ABA56887.1 GB:DB_XREF GI:76882206 InterPro:IPR000555 LENGTH 134 SQ:AASEQ MAEVILPRPLVNQLLHQAQVKPQQEICGLISARNGLPSRCYPINNIAPEPQRHFFMDPQGQIAAMRRMREEGEELFGIYHSHPETAPLPSKSDLAQAAYPGALYLIISLNTKGVLEMRGFRLQGEVYEEIELQL GT:EXON 1|1-134:0| BL:SWS:NREP 1 BL:SWS:REP 4->129|Y1369_MYCBO|7e-09|28.8|125/146| SEG 65->74|mrrmreegee| BL:PDB:NREP 1 BL:PDB:REP 4->109|2kksA|2e-12|35.2|105/146| HM:PFM:NREP 1 HM:PFM:REP 59->97|PF01398|1.6e-07|28.9|38/116|Mov34| HM:SCP:REP 1->132|1oi0A_|1.3e-26|40.5|121/0|c.97.3.1|1/1|JAB1/MPN domain| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN ------------------------------1---------------------------------1--- -------------------------------------------1-----------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------11-----------------------1--1----11-----------1----1------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------1-1------------------111-1-1-------------------------------1--------------------------------------1---------------------------------------------------------------------------------------------------------1-1--------------------------------------------------------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 105 STR:RPRED 78.4 SQ:SECSTR ###EEEEHHHHHHHHHHHHHHTTccEEEEEEEEEETTEEEEcccccccccc#cccccHHHHHHHHHHHHHHTcEEEEEEEEEccccccccHHHHTTccccccEEEEEEc######################### DISOP:02AL 134-135| PSIPRED cEEEEEcHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEEcccccccccEEEEEcHHHHHHHHHHHHHcccEEEEEEEccccccccccHHHHHHHHcccccEEEEEcccccEEEEEEEEEEccEEEEEEEEc //