[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56892.1
DDBJ      :             Uracil phosphoribosyltransferase
Swiss-Prot:PYRR_NITOC   RecName: Full=Bifunctional protein pyrR;Includes:  RecName: Full=Pyrimidine operon regulatory protein;Includes:  RecName: Full=Uracil phosphoribosyltransferase;           Short=UPRTase;           EC=2.4.2.9;

Homologs  Archaea  0/68 : Bacteria  448/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.61.1
:177 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   30->158 1a3cA PDBj 4e-28 45.5 %
:RPS:PDB   24->150 1a3cA PDBj 1e-11 42.3 %
:RPS:SCOP  24->160 1a3cA  c.61.1.1 * 9e-24 43.5 %
:HMM:SCOP  5->164 1w30A_ c.61.1.1 * 1.4e-32 34.4 %
:HMM:PFM   15->132 PF00156 * Pribosyltran 7.8e-20 28.3 113/125  
:BLT:SWISS 1->177 PYRR_NITOC e-100 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56892.1 GT:GENE ABA56892.1 GT:PRODUCT Uracil phosphoribosyltransferase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(399846..400379) GB:FROM 399846 GB:TO 400379 GB:DIRECTION - GB:PRODUCT Uracil phosphoribosyltransferase GB:PROTEIN_ID ABA56892.1 GB:DB_XREF GI:76882211 InterPro:IPR000836 LENGTH 177 SQ:AASEQ MNIPQPVSLNIDALFRNLATGLNQRMAEQERNKPAMIGIHTGGVWVAERLLNQLDNLVSDPLGVLNIAYYRDDFTRIGMHPQVQPSQLPFSVADRHIILVDDVLYTGRTVRAALNEIFDYGRPASVTLAALVERAGRELPIQADVVGHHLDLAPNEQVKLTGPDPLQFSIQYIDPTE GT:EXON 1|1-177:0| SW:ID PYRR_NITOC SW:DE RecName: Full=Bifunctional protein pyrR;Includes: RecName: Full=Pyrimidine operon regulatory protein;Includes: RecName: Full=Uracil phosphoribosyltransferase; Short=UPRTase; EC=2.4.2.9; SW:GN Name=pyrR; OrderedLocusNames=Noc_0366; SW:KW Complete proteome; Glycosyltransferase; Transcription;Transcription regulation; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->177|PYRR_NITOC|e-100|100.0|177/177| GO:SWS:NREP 4 GO:SWS GO:0016757|"GO:transferase activity, transferring glycosyl groups"|Glycosyltransferase| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 30->158|1a3cA|4e-28|45.5|123/166| RP:PDB:NREP 1 RP:PDB:REP 24->150|1a3cA|1e-11|42.3|123/166| HM:PFM:NREP 1 HM:PFM:REP 15->132|PF00156|7.8e-20|28.3|113/125|Pribosyltran| RP:SCP:NREP 1 RP:SCP:REP 24->160|1a3cA|9e-24|43.5|131/166|c.61.1.1| HM:SCP:REP 5->164|1w30A_|1.4e-32|34.4|160/0|c.61.1.1|1/1|PRTase-like| OP:NHOMO 468 OP:NHOMOORG 448 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11--1111111111111111111111111111111111--11111111111-------11111-----------------1111111121--------------------------111111111-1111111111111111111111111111-11111-1111111111111111111111111111111111111111111111111111111111111111111111111212112122222111111111-1111111111111111111111111111111111111111111111111111222222212111111111-11--1--111111111111111111-11----------------------------------------------------------------------------------------------------------------------------------111111111111111111111111111111111111111111111212111---------111111--11111111111111111111111111-111-------------------------11----1----------------------------1111------------------------------------------------------------------------------------------------------111-111111111111-111----------1-11111111111111111----------------------------------------11-----------------------------------1------1--11-1----11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 167 STR:RPRED 94.4 SQ:SECSTR #TTEEEEEEHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHcHHHHHccccEEEEEEEEcccccccEEEEEEcccccTTcEEEEEEEEEcccHHHHHHHHHHHHHccccEEEEEEEEEcccccccccccEEEEEccEcccccEEcccHHHHEE######### DISOP:02AL 1-4, 75-77, 80-82, 176-177| PSIPRED ccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEccccEEHHHHHHHHHHHHccccEEEEEEEEEcccccccccEEEEccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccccccccEEEEEcccccccEEEEEEccccccEEEcccccc //