[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56896.1
DDBJ      :             Outer membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  342/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
a.102.3
:588 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   71->280 3efcA PDBj 4e-18 13.3 %
:RPS:SCOP  160->492 1hv6A  a.102.3.1 * 1e-13 5.5 %
:RPS:PFM   373->588 PF01103 * Bac_surface_Ag 7e-20 32.2 %
:HMM:PFM   304->586 PF01103 * Bac_surface_Ag 5.2e-48 26.4 280/323  
:HMM:PFM   138->178 PF07244 * Surf_Ag_VNR 3.3e-07 29.3 41/78  
:HMM:PFM   205->271 PF07244 * Surf_Ag_VNR 8.9e-09 23.4 64/78  
:BLT:SWISS 37->588 YTFM_ECOLI 8e-73 31.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56896.1 GT:GENE ABA56896.1 GT:PRODUCT Outer membrane protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 402714..404480 GB:FROM 402714 GB:TO 404480 GB:DIRECTION + GB:PRODUCT Outer membrane protein GB:PROTEIN_ID ABA56896.1 GB:DB_XREF GI:76882215 InterPro:IPR000184 InterPro:IPR010827 LENGTH 588 SQ:AASEQ MKINKIVLAFPVRIFFCLLLFFVKIGAAWSQVYLETEVEGVKGEALENVMAYLSIAHQKEDAQLAEGVIRRLHGKAEDEIKTALAVYGYYQPRIEAELQQHPKRWLARYRIDPGPRMRVGEVDLTVTGGGAEDSAFQALQQNFPIKEGEFLNQTHYEQGKSALQRLAAERGYFQANFTQQVLRINLETYSARAILRFDTGPRYQFGPVTFTETVLRPQLLTRYVPFQEGEFYQSSKVVELQTALVDSDYFAVVEVEPRPQQAAELKVPISVYLQAEKRNRYSVGVGFGTNTGPRLNLGWKNRYVNRYGHRFSFALNTSKINQTLDSSYIIPIGDPRTDQVRIASSIGRRSTVTSNSHIALFGARRIVARPGGWQETLFLDYRWEDFDVGGDSGLAKLLIPGISWFRRQADDPVYPQRGNRLSLELQGAAQELLSNNTFLQLTLQGKIIRRLGRRSRLLVRGDAGATWVSDFANLPPSVRYFAGGDQSVRGYAFSSLGATNERGRVIGGKNILVGSVEYEYRFLDKWAAAAFYDAGNAFNNFSSLEVQQGAGVGVRWISPVGPIRVDFAFALSKSGTPFRLHVNLGPDL GT:EXON 1|1-588:0| BL:SWS:NREP 1 BL:SWS:REP 37->588|YTFM_ECOLI|8e-73|31.3|546/577| TM:NTM 1 TM:REGION 4->26| SEG 449->461|rrlgrrsrllvrg| SEG 527->541|aaaafydagnafnnf| RP:PDB:NREP 1 RP:PDB:REP 71->280|3efcA|4e-18|13.3|210/327| RP:PFM:NREP 1 RP:PFM:REP 373->588|PF01103|7e-20|32.2|211/317|Bac_surface_Ag| HM:PFM:NREP 3 HM:PFM:REP 304->586|PF01103|5.2e-48|26.4|280/323|Bac_surface_Ag| HM:PFM:REP 138->178|PF07244|3.3e-07|29.3|41/78|Surf_Ag_VNR| HM:PFM:REP 205->271|PF07244|8.9e-09|23.4|64/78|Surf_Ag_VNR| GO:PFM:NREP 1 GO:PFM GO:0019867|"GO:outer membrane"|PF01103|IPR000184| RP:SCP:NREP 1 RP:SCP:REP 160->492|1hv6A|1e-13|5.5|326/351|a.102.3.1| OP:NHOMO 364 OP:NHOMOORG 345 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111---12--------------------1111111--11-111-11111111-111-----------11111111-11-1-11------------------------------11-12111111111111111111121111111111222--11111111111111111112-111111111111111-1--111-11----1111-1--11------11---1----------------1---11122111-1111112222222111111221111-11112------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111-11-111111111-111-11111111111111111111111111111111111111111111----------1111111111111111111111111111--1-------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 210 STR:RPRED 35.7 SQ:SECSTR ######################################################################GGHHHHHHHHHHHHHTTTccccEEEEEcccTTcEEEEEEEEEccccccccccEEEccccccTTTccccccccccccTTTHHHHHHHHHHHHHHHHHHHHTTcTTcEEEEcccEEcTTcccEEcEEEEEcccccEEEEEcccccTTcHHHHHHTccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEEETTTTEEEEEEEEcccccc#################################################################################################################################################################################################################################################################################################################### DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEEEcccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEcccccEEEEEEEEcccEEEEEEEEEEEEcccccHHHHHHHHHHHccccccEEcHHHHHHHHHHHHHHHHHcccEEEEEEcccEEEcccccEEEEEEEEccccEEEEEEEEEEcEEEcHHHHHHHHcccccccccHHHHHHHHHHHHHcccEEEEEEEEEEccccccEEEEEEEEEEccccEEEEEEEEcccccEEEEEEEEEccccccccEEEEEEEEcccEEEEEEEEEcccccccccEEEEEEEEEEEEEEccEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEEEEccccccEEEEEEEEEEEEEEccccccccEEEEEEEEEEEcccccccccEEEEEEEEEEEEEEccccEEEEEEEEEEEEEEcccccccHHHHHHcccccEEEEEEccccccccccccccccEEEEEEEEEEEEEEccccEEEEEEEEEEEEcccccccEEEEEEEEEEEEccEEEEEEEEEEEEEcccccEEEEEEEcccc //