[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56906.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  10/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:371 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56906.1 GT:GENE ABA56906.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(421262..422377) GB:FROM 421262 GB:TO 422377 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA56906.1 GB:DB_XREF GI:76882225 LENGTH 371 SQ:AASEQ MESVTEERLWEEWLLRTDEPSGEIIGGWFAGVVDPEVWRHGYAMQHLLRRVGKELLAPVAEHLGEAKRLLLVTHGGLHLLPLEAAPFPAGNGAMTTLSERMAVSVTPSAVFLAENRQHARGSEQSWRLVALENPRNDPQLPYTSLEVARIAHYAGAERTTRLRGKEATLPALAENLAGATFNHFSCHGRYHWGSPLLSALELHPAEGEPTVEGGEPGHLTLLHLYQGKVDFTGARLVTLSACQTGITEVREQAEEAVGLPGGLLGAGVPTVVASLWSVADLSTAFLMSRFYYHLLCQAHPPDRALQQAQADTRTATWKQIREELEEQAVLNASDKLGDEGELDQRPFAQPYHWAAFQVWGDGWTPIIQEDA GT:EXON 1|1-371:0| SEG 6->16|eerlweewllr| SEG 69->82|lllvthgglhllpl| SEG 204->217|paegeptveggepg| SEG 253->273|aeeavglpggllgagvptvva| OP:NHOMO 14 OP:NHOMOORG 12 OP:PATTERN --------------------------------------------1----------------------- ---------------------------------------------------------------------------------------------------------------------------------1----------1-------2---1----------1---2111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 36-41, 113-130, 367-371| PSIPRED ccccccHHHHHHHcccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHHccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHcccccEEEEEccEEEcccccccccEEEccccccccccccccccccHHHHHHHHcccccccEEEEEcccccccccccccHHHHHHHHHHHHHcHHHHHHccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHcccccccccccccEEEEcccccccccccc //