[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56910.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   60->126 3d1nN PDBj 9e-06 16.4 %
:RPS:SCOP  60->126 1y7yA1  a.35.1.3 * 5e-05 29.2 %
:HMM:SCOP  56->126 1y7yA1 a.35.1.3 * 2.1e-07 29.0 %
:HMM:PFM   69->98 PF01381 * HTH_3 7.6e-05 36.7 30/55  
:BLT:SWISS 45->106 RPO2_VACCT 4e-04 28.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56910.1 GT:GENE ABA56910.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 425856..426236 GB:FROM 425856 GB:TO 426236 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA56910.1 GB:DB_XREF GI:76882229 LENGTH 126 SQ:AASEQ MLLARCAKSSGAPIRPVPHLIQKRDKHPCVMIRATLDQYLEEDRVSAKTLHDEAKQRHGDDYRTPGYYLRLYRHRAERTQAELAEKTGLRQHHLSEMEHHKGVIGNANANAKKLAPILDCDYRKLL GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 45->106|RPO2_VACCT|4e-04|28.8|59/100| RP:PDB:NREP 1 RP:PDB:REP 60->126|3d1nN|9e-06|16.4|67/82| HM:PFM:NREP 1 HM:PFM:REP 69->98|PF01381|7.6e-05|36.7|30/55|HTH_3| RP:SCP:NREP 1 RP:SCP:REP 60->126|1y7yA1|5e-05|29.2|65/69|a.35.1.3| HM:SCP:REP 56->126|1y7yA1|2.1e-07|29.0|69/0|a.35.1.3|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 5 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----2--------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 67 STR:RPRED 53.2 SQ:SECSTR ###########################################################HHHHHHHHHHHHHHHHTTccHHHHHHHHHHHcGGGcHHHHHHHHTTcccHHHHHHHHHHHHHHHHHH DISOP:02AL 1-9, 52-53, 56-57| PSIPRED cccccccccccccccHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccccccccccHHHHHHHHcccHHHcc //