[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56911.1
DDBJ      :             putative transposase gene of IS630 family insertion sequence ISY100h
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  79/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
:174 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   85->144 PF03184 * DDE 3.7e-05 23.3 60/217  
:BLT:SWISS 113->174 TC3A_CAEEL 5e-04 32.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56911.1 GT:GENE ABA56911.1 GT:PRODUCT putative transposase gene of IS630 family insertion sequence ISY100h GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(426788..427312) GB:FROM 426788 GB:TO 427312 GB:DIRECTION - GB:PRODUCT putative transposase gene of IS630 family insertion sequence ISY100h GB:PROTEIN_ID ABA56911.1 GB:DB_XREF GI:76882230 LENGTH 174 SQ:AASEQ MTGYTQRCNMKRKSFLRLRERYRRRGKRFVYLDESGFEPEVSRRYAYAPKGRRVYGLISGHRRPRTSLLAARMDEGFEAPFLFEGTCNTAVFNAWLEKELCPLLNSNHIVIMDNVPFHKAVSSREIIKKTGAGILFLPPYSPDFNPIEKDFGNIKKIREYNEHETLENIVAAYQ GT:EXON 1|1-174:0| BL:SWS:NREP 1 BL:SWS:REP 113->174|TC3A_CAEEL|5e-04|32.8|61/100| SEG 12->29|rksflrlreryrrrgkrf| HM:PFM:NREP 1 HM:PFM:REP 85->144|PF03184|3.7e-05|23.3|60/217|DDE| OP:NHOMO 750 OP:NHOMOORG 88 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------3--------------1------I45B15UD----------R-3-3-9------------1---------------------------------------------------------------------------------------------------------73-11-2-211--------------34---444--------------------------------------------------2---9--------4----4S-----2----------B-3111-F11----1---5-7--17D2----4--------1--------253--1------------2Q------1---------3--1-1---------------------------------------------8---7---------16---1-17-1----------------------------------------------------------------------------------------------I----------------------------------------------------------------------------------------------Q--------------------------------------2-E-------------------kv-c-muk---------------------------------------------------------------------------------------- -------------------------31-------------------1---2--------------------------------------3-----------91--6-------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 174-175| PSIPRED cccccHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccEEEEccccEEEEEEccccccEEEEEEEEEcccEEEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHc //