[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56915.1
DDBJ      :             Polynucleotide adenylyltransferase
Swiss-Prot:CCA_NITOC    RecName: Full=Multifunctional CCA protein;Includes:  RecName: Full=CCA-adding enzyme;           EC=2.7.7.25;           EC=2.7.7.21;  AltName: Full=tRNA nucleotidyltransferase;  AltName: Full=tRNA adenylyl-/cytidylyl-transferase;  AltName: Full=tRNA CCA-pyrophosphorylase;  AltName: Full=tRNA-NT;Includes:  RecName: Full=2'-nucleotidase;           EC=3.1.3.-;Includes:  RecName: Full=2',3'-cyclic phosphodiesterase;           EC=3.1.4.-;Includes:  RecName: Full=Phosphatase;           EC=3.1.3.-;

Homologs  Archaea  1/68 : Bacteria  719/915 : Eukaryota  3/199 : Viruses  1/175   --->[See Alignment]
a.173.1d.218.1
:406 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->194 1vfgB PDBj 6e-18 40.4 %
:RPS:PDB   10->308 3bjdC PDBj 7e-35 17.2 %
:RPS:SCOP  1->118 1ou5A2  d.218.1.4 * 7e-26 27.3 %
:RPS:SCOP  120->325 1ou5A1  a.173.1.1 * 4e-26 14.4 %
:HMM:SCOP  1->119 1miwA2 d.218.1.4 * 1e-29 49.1 %
:HMM:SCOP  120->360 1vfgA1 a.173.1.1 * 3.6e-54 38.3 %
:RPS:PFM   3->122 PF01743 * PolyA_pol 7e-17 51.7 %
:HMM:PFM   3->122 PF01743 * PolyA_pol 1.4e-27 43.6 117/126  
:HMM:PFM   226->323 PF01966 * HD 1.1e-12 28.3 92/118  
:BLT:SWISS 1->406 CCA_NITOC 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56915.1 GT:GENE ABA56915.1 GT:PRODUCT Polynucleotide adenylyltransferase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(429381..430601) GB:FROM 429381 GB:TO 430601 GB:DIRECTION - GB:PRODUCT Polynucleotide adenylyltransferase GB:PROTEIN_ID ABA56915.1 GB:DB_XREF GI:76882234 InterPro:IPR002646 InterPro:IPR003607 InterPro:IPR006674 LENGTH 406 SQ:AASEQ MEVYLVGGAVRDKLLGRPVKERDYVVVGTTPANLLAQGYRPVGKDFPVFLHPQTQEEYALARTERKTGPGYKGFEVDAAPDVTLEEDLQRRDLTINAIAEAADGSLLDPFGGQQDLARGILRHVSPAFAEDPVRILRAARFAARFNFKVAPETLALMEAMVTAGEADHLVPERVWRELERALGESYPRRFFEILRACGALARIFPEIECLFGVPQPRRYHPEIDTGIHTLKVLEIAAHLSSDTQVRFAALTHDLGKGQTPSHEWPHHYGHGERGVALVLTLCQRLRVPKAYQALAVQVARYHNLVHQAQELRPGTILKLLNRVDAFRRPSRFEQFLLACEADARGRSGLENRPYPQANQLRLAFRAAAAVTARPLVAAGLRGEAIAEQLQQQRIKAIKQAVHTERG GT:EXON 1|1-406:0| SW:ID CCA_NITOC SW:DE RecName: Full=Multifunctional CCA protein;Includes: RecName: Full=CCA-adding enzyme; EC=2.7.7.25; EC=2.7.7.21; AltName: Full=tRNA nucleotidyltransferase; AltName: Full=tRNA adenylyl-/cytidylyl-transferase; AltName: Full=tRNA CCA-pyrophosphorylase; AltName: Full=tRNA-NT;Includes: RecName: Full=2'-nucleotidase; EC=3.1.3.-;Includes: RecName: Full=2',3'-cyclic phosphodiesterase; EC=3.1.4.-;Includes: RecName: Full=Phosphatase; EC=3.1.3.-; SW:GN Name=cca; OrderedLocusNames=Noc_0389; SW:KW ATP-binding; Complete proteome; Hydrolase; Magnesium; Metal-binding;Multifunctional enzyme; Nickel; Nucleotide-binding;Nucleotidyltransferase; RNA repair; RNA-binding; Transferase;tRNA processing. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->406|CCA_NITOC|0.0|100.0|406/406| GO:SWS:NREP 10 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0042245|"GO:RNA repair"|RNA repair| GO:SWS GO:0003723|"GO:RNA binding"|RNA-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0008033|"GO:tRNA processing"|tRNA processing| SEG 137->147|raarfaarfnf| SEG 360->378|lrlafraaaavtarplvaa| BL:PDB:NREP 1 BL:PDB:REP 1->194|1vfgB|6e-18|40.4|178/358| RP:PDB:NREP 1 RP:PDB:REP 10->308|3bjdC|7e-35|17.2|273/320| RP:PFM:NREP 1 RP:PFM:REP 3->122|PF01743|7e-17|51.7|116/123|PolyA_pol| HM:PFM:NREP 2 HM:PFM:REP 3->122|PF01743|1.4e-27|43.6|117/126|PolyA_pol| HM:PFM:REP 226->323|PF01966|1.1e-12|28.3|92/118|HD| GO:PFM:NREP 3 GO:PFM GO:0003723|"GO:RNA binding"|PF01743|IPR002646| GO:PFM GO:0006396|"GO:RNA processing"|PF01743|IPR002646| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF01743|IPR002646| RP:SCP:NREP 2 RP:SCP:REP 1->118|1ou5A2|7e-26|27.3|110/140|d.218.1.4| RP:SCP:REP 120->325|1ou5A1|4e-26|14.4|194/204|a.173.1.1| HM:SCP:REP 1->119|1miwA2|1e-29|49.1|116/139|d.218.1.4|1/1|Nucleotidyltransferase| HM:SCP:REP 120->360|1vfgA1|3.6e-54|38.3|214/215|a.173.1.1|1/1|Poly A polymerase C-terminal region-like| OP:NHOMO 820 OP:NHOMOORG 724 OP:PATTERN ---------------------------------------------------1---------------- 122-111111111111111-111111111111111111111111-11111111211111111111111111111111111121211-1111111--11-11111111111111111122211111111111111111--22111112111---21111----11-121111------------1-1--12--11111111111111111121111111111111----1--11-1111111--11111-111111-111111-111111-1-11-1-1111111111--1111111111111111111111111111111111-21--111111111-1111----1121-1-1122221111121-11-111-1-----11111-1-----------1111111111-----------1--111111-11-11-1--1-------11-111111111---1-----------------------------------1--1111111111111111111111111111111111111111111111111111111111111111111112111112232222221-3332333111121-12111111111111--11111111111133121111111111111111111111-111111-2122111111121111211111111111-1111111111111111112222111111111111111111111111111111111111111111111111111121222112211112112222222111111111111111111111111111111111111111212211111111111212222222222221111--------------11--------------------------11-1111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------3--------------1--------------------2---- ------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------ STR:NPRED 331 STR:RPRED 81.5 SQ:SECSTR ccEEEETHHcTTHHHTcccHHHHHHHTTccHHHHcHHHHHHHHHEEHHHHHHHHcccGGGHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccGGGcHHHHHTTTcccHHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHcHHHHHHHHHHHHHHHHTTTTcGGGcHHHHHHHHHHHTTccccTTccccHHHHHHHHHHHHHHGccccccHcccTHHHHHHHHHHHTcHHHHcHHHccHHHHHHHHHHTTccTTTTHHHHTTcccccGGGcTTHHHHHTcHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHH########################################################################### DISOP:02AL 404-406| PSIPRED cEEEEEcHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHHHHccEEEEEcccEEEEEEEEEEEEcccccccEEEEcccccHHHHHHccccccHHHcccccccEEccccHHHHHHccEEEccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHHHccccccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHcccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcc //