[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56924.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.298.1
:95 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  1->89 1z8mA1 d.298.1.2 * 9.6e-06 35.9 %
:HMM:PFM   10->86 PF05016 * Plasmid_stabil 1e-05 23.6 72/88  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56924.1 GT:GENE ABA56924.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(441899..442186) GB:FROM 441899 GB:TO 442186 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA56924.1 GB:DB_XREF GI:76882243 LENGTH 95 SQ:AASEQ MAKATRVLQSPTFKKAVKKLKANQKKDLDTAVKDLMADPALGEQKKGDLSFLRGYKFKMNKHLILLGYSFDDGALVLELMALSSHENFYRNIKQR GT:EXON 1|1-95:0| SEG 14->29|kkavkklkanqkkdld| HM:PFM:NREP 1 HM:PFM:REP 10->86|PF05016|1e-05|23.6|72/88|Plasmid_stabil| HM:SCP:REP 1->89|1z8mA1|9.6e-06|35.9|78/0|d.298.1.2|1/1|RelE-like| OP:NHOMO 22 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------1-----1-----------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------1----------------1---------------------1------1-------------------1--------------------------------------11----1------------------------1----------1--1-------------------2------------------1--------------------------------------------------------1----------------------1------------------------------------------11-------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 93-95| PSIPRED cccccEEcccccHHHHHHHccHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEccEEEEEEEEEEcccEEEEEEEEcccHHHHHHHHcc //