[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56937.1
DDBJ      :             helix-turn-helix protein, CopG family
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  22/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.43.1
:77 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   32->71 1ea4B PDBj 3e-05 20.0 %
:RPS:SCOP  32->72 1b01A  a.43.1.3 * 1e-04 19.5 %
:HMM:SCOP  31->73 2cpgA_ a.43.1.3 * 0.00094 32.6 %
:HMM:PFM   34->72 PF01402 * RHH_1 6.6e-06 33.3 39/39  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56937.1 GT:GENE ABA56937.1 GT:PRODUCT helix-turn-helix protein, CopG family GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 453877..454110 GB:FROM 453877 GB:TO 454110 GB:DIRECTION + GB:PRODUCT helix-turn-helix protein, CopG family GB:PROTEIN_ID ABA56937.1 GB:DB_XREF GI:76882256 LENGTH 77 SQ:AASEQ MKAKSFDAKFEKGEDVTKSLDLSKARRPLQEQRRVNVDFPAWMVESLDREAGRLGVTRQSVIKVWLAERLEQIASNK GT:EXON 1|1-77:0| RP:PDB:NREP 1 RP:PDB:REP 32->71|1ea4B|3e-05|20.0|40/41| HM:PFM:NREP 1 HM:PFM:REP 34->72|PF01402|6.6e-06|33.3|39/39|RHH_1| RP:SCP:NREP 1 RP:SCP:REP 32->72|1b01A|1e-04|19.5|41/43|a.43.1.3| HM:SCP:REP 31->73|2cpgA_|0.00094|32.6|43/0|a.43.1.3|1/1|Ribbon-helix-helix| OP:NHOMO 25 OP:NHOMOORG 22 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------1----1----------------------------------------------2-1---2----------------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1-----------1-1--1-1-------1------------------------------1---------------------------------------2--1----------------------------------------------------------------------------------------------------------1------------------------------------------------------1---1-11------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 41 STR:RPRED 53.2 SQ:SECSTR ###############################cccccccccHHHHHHHHHHHHHTTccHHHHHHHHHHHHccc##### DISOP:02AL 1-4, 73-77| PSIPRED cccccHHHHHcccccEEEcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccc //