[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56941.1
DDBJ      :             putative plasmid maintenance system antidote protein VapI
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  54/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.35.1
:78 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->63 3cecA PDBj 9e-08 37.1 %
:RPS:PDB   1->63 3cecA PDBj 1e-18 37.1 %
:RPS:SCOP  2->63 2icpA1  a.35.1.3 * 1e-08 36.1 %
:HMM:SCOP  1->44 2a6cA1 a.35.1.13 * 9.5e-06 36.4 %
:RPS:PFM   2->42 PF01381 * HTH_3 3e-04 41.5 %
:HMM:PFM   2->43 PF01381 * HTH_3 4.5e-11 40.5 42/55  
:BLT:SWISS 1->75 VAPA_DICNO 6e-15 45.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56941.1 GT:GENE ABA56941.1 GT:PRODUCT putative plasmid maintenance system antidote protein VapI GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 456683..456919 GB:FROM 456683 GB:TO 456919 GB:DIRECTION + GB:PRODUCT putative plasmid maintenance system antidote protein VapI GB:PROTEIN_ID ABA56941.1 GB:DB_XREF GI:76882260 InterPro:IPR002197 LENGTH 78 SQ:AASEQ MGLSVTEAARHLGISRKTLSKVLNGRGVITPEMALRLEMAFGKPNAAHWLRLQNAYDLWQTRQHCADMHVTPVKTHVA GT:EXON 1|1-78:0| BL:SWS:NREP 1 BL:SWS:REP 1->75|VAPA_DICNO|6e-15|45.9|74/102| BL:PDB:NREP 1 BL:PDB:REP 1->63|3cecA|9e-08|37.1|62/90| RP:PDB:NREP 1 RP:PDB:REP 1->63|3cecA|1e-18|37.1|62/90| RP:PFM:NREP 1 RP:PFM:REP 2->42|PF01381|3e-04|41.5|41/55|HTH_3| HM:PFM:NREP 1 HM:PFM:REP 2->43|PF01381|4.5e-11|40.5|42/55|HTH_3| GO:PFM:NREP 1 GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01381|IPR001387| RP:SCP:NREP 1 RP:SCP:REP 2->63|2icpA1|1e-08|36.1|61/87|a.35.1.3| HM:SCP:REP 1->44|2a6cA1|9.5e-06|36.4|44/0|a.35.1.13|1/1|lambda repressor-like DNA-binding domains| OP:NHOMO 74 OP:NHOMOORG 54 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------3--------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------23-3-----1-11----------------------------1----------11------1---------------111----1-----------------------------------------11-1----------------1----1-------1-----------1-----1-1-----2--1-----1-----1-1---------2-1-------------------------------------------1-----------------------35---------------------------------------------------11---------------------------1-------------1-------------21---1-------3---------1---1-----21-1--1---1------------------------------------1121----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 76 STR:RPRED 97.4 SQ:SECSTR HTccHHHHHHHHTccHHHHHHHHTTcccccHHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHcTTcHHHHccTTT## DISOP:02AL 77-78| PSIPRED ccccHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcHHHHcccccccc //