[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56946.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:160 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   31->132 PF01864 * DUF46 2e-07 41.6 %
:HMM:PFM   69->144 PF01864 * DUF46 3.1e-10 34.7 75/175  
:HMM:PFM   33->79 PF01694 * Rhomboid 0.0004 28.9 38/146  
:BLT:SWISS 11->111 Y1639_HYPBU 3e-10 42.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56946.1 GT:GENE ABA56946.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(461778..462260) GB:FROM 461778 GB:TO 462260 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA56946.1 GB:DB_XREF GI:76882265 LENGTH 160 SQ:AASEQ MDLLSPLLLLMVANGAPVVTALLLKNRFNQPLDGNLHLPDGYPLFGASKTIRGIVAALLATAFIAPLFNFSFITGALVGFWAMVGDLLSSFIKRRLGRQPSSAHMPGLDHIPEALLPLCFLRSQMLLSWPEVALIILAFTLLDLFLWFLLNRLYSLFHSR GT:EXON 1|1-160:0| BL:SWS:NREP 1 BL:SWS:REP 11->111|Y1639_HYPBU|3e-10|42.1|95/168| TM:NTM 3 TM:REGION 4->25| TM:REGION 62->84| TM:REGION 126->148| SEG 3->10|llspllll| SEG 134->157|liilaftlldlflwfllnrlyslf| RP:PFM:NREP 1 RP:PFM:REP 31->132|PF01864|2e-07|41.6|101/171|DUF46| HM:PFM:NREP 2 HM:PFM:REP 69->144|PF01864|3.1e-10|34.7|75/175|DUF46| HM:PFM:REP 33->79|PF01694|0.0004|28.9|38/146|Rhomboid| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------1---------------------------------------------------------------------------------------------------------1-1----------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 159-159| PSIPRED ccHHHHHHHHHHHcccHHHHHHHHHccccccccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //