[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56955.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->53 PF03843 * Slp 0.00044 17.2 29/160  
:HMM:PFM   5->36 PF07426 * Dynactin_p22 0.00064 21.9 32/172  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56955.1 GT:GENE ABA56955.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(471644..471820) GB:FROM 471644 GB:TO 471820 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA56955.1 GB:DB_XREF GI:76882274 LENGTH 58 SQ:AASEQ MEKERYVEPGYVEEEYVPEPLKVRLTPEEEKAIGQNPVELIWLAEQVYEYWRANTPSA GT:EXON 1|1-58:0| SEG 4->20|eryvepgyveeeyvpep| HM:PFM:NREP 2 HM:PFM:REP 25->53|PF03843|0.00044|17.2|29/160|Slp| HM:PFM:REP 5->36|PF07426|0.00064|21.9|32/172|Dynactin_p22| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 56-58| PSIPRED ccccccccccccccccccccEEEEEcccHHHHcccccHHHHHHHHHHHHHHccccccc //