[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56977.1
DDBJ      :             membrane protein, putative
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  13/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:302 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   21->286 PF09991 * DUF2232 1.7e-12 23.9 264/290  
:BLT:SWISS 103->260 CYOE2_PSEPF 9e-04 27.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56977.1 GT:GENE ABA56977.1 GT:PRODUCT membrane protein, putative GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(488237..489145) GB:FROM 488237 GB:TO 489145 GB:DIRECTION - GB:PRODUCT membrane protein, putative GB:PROTEIN_ID ABA56977.1 GB:DB_XREF GI:76882296 LENGTH 302 SQ:AASEQ MREFARFIMRGRLYAIATAGLFGALAVALPPLSLFSGATVGLTTLRHGMKEGLSITAGATLVVAAIFLAITGRADLSLLLLLGLWLPNTLGCWILRITQSQASTLLMVGGFSALFVVSMHALTGDVTAWWQQWIEQAMTRANIEGVTVEEIAQEGALTLMNGLVAMIFGLNLMLTILLARWWQSLLYNPGGFAKEFYELRLPRILTYLTVLLSAPVLTGALGERGHILTDLFIVAVMMYLFQGLAAMHSMTAARNLSQWWLLPIYLGLFLLPPHFIIGLALVGVVDGLINLRGNPPPPPTKA GT:EXON 1|1-302:0| BL:SWS:NREP 1 BL:SWS:REP 103->260|CYOE2_PSEPF|9e-04|27.9|147/100| TM:NTM 7 TM:REGION 19->41| TM:REGION 57->79| TM:REGION 107->129| TM:REGION 161->183| TM:REGION 201->223| TM:REGION 226->248| TM:REGION 264->286| SEG 76->90|lslllllglwlpntl| SEG 261->273|llpiylglfllpp| HM:PFM:NREP 1 HM:PFM:REP 21->286|PF09991|1.7e-12|23.9|264/290|DUF2232| OP:NHOMO 14 OP:NHOMOORG 13 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------1-11------------------------------------------------------------------------------------------------------2---1--------------------------------1-1-----1111---------1--------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 294-302| PSIPRED ccHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccc //