[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56981.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:210 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   37->61 PF06779 * DUF1228 0.00012 32.0 25/85  
:HMM:PFM   107->157 PF04610 * TrbL 0.00025 27.5 51/225  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56981.1 GT:GENE ABA56981.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 492683..493315 GB:FROM 492683 GB:TO 493315 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA56981.1 GB:DB_XREF GI:76882300 LENGTH 210 SQ:AASEQ MNNRDYYGLYGLILGGLVDVTIFLQSASADVRAVLIKEGGFVESLSAIGYFVGAILVILIRRKFIYYTYAAFILILFGLRELDFHNRFTTMSVSKIKFYVSPEVLLLEKVIAIAIVLLLLYILIRLIKTHFNGLINAIKKGEPSALGVGGGILLILITKTLDGLSRKLASVNIIVSDNMAKLVETVEEVFELGIPLMFIIAAAARFRTAR GT:EXON 1|1-210:0| TM:NTM 5 TM:REGION 6->28| TM:REGION 34->56| TM:REGION 64->86| TM:REGION 109->131| TM:REGION 184->205| SEG 6->17|yyglyglilggl| SEG 104->127|vlllekviaiaivllllyilirli| SEG 146->164|lgvgggillilitktldgl| SEG 198->209|fiiaaaarfrta| HM:PFM:NREP 2 HM:PFM:REP 37->61|PF06779|0.00012|32.0|25/85|DUF1228| HM:PFM:REP 107->157|PF04610|0.00025|27.5|51/225|TrbL| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //