[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA56985.1
DDBJ      :             Protein of unknown function DUF202
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   20->45 PF02656 * DUF202 4e-04 53.8 %
:HMM:PFM   20->81 PF02656 * DUF202 3e-15 30.6 62/70  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA56985.1 GT:GENE ABA56985.1 GT:PRODUCT Protein of unknown function DUF202 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(495784..496167) GB:FROM 495784 GB:TO 496167 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF202 GB:PROTEIN_ID ABA56985.1 GB:DB_XREF GI:76882304 InterPro:IPR003807 LENGTH 127 SQ:AASEQ MPEKSKQQLATDRTELAFHRNLLAEQRTFSAWMRTGIAAIALGFADIKLLAEAEPKWAVYAAGVILIVIGMAIHILSFWGYYVTFRALKEEGLPGLPIWSVVLITLSLFIAGLLILILLLAGLIDSP GT:EXON 1|1-127:0| TM:NTM 3 TM:REGION 31->53| TM:REGION 59->81| TM:REGION 98->120| SEG 106->124|lslfiagllililllagli| RP:PFM:NREP 1 RP:PFM:REP 20->45|PF02656|4e-04|53.8|26/75|DUF202| HM:PFM:NREP 1 HM:PFM:REP 20->81|PF02656|3e-15|30.6|62/70|DUF202| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-15| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //