[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57005.1
DDBJ      :             Protein of unknown function DUF1328
Swiss-Prot:Y482_NITOC   RecName: Full=UPF0391 membrane protein Noc_0482;

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:56 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->44 PF07043 * DUF1328 8.1e-17 56.4 39/39  
:BLT:SWISS 1->32 Y482_NITOC 1e-14 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57005.1 GT:GENE ABA57005.1 GT:PRODUCT Protein of unknown function DUF1328 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(517419..517589) GB:FROM 517419 GB:TO 517589 GB:DIRECTION - GB:PRODUCT Protein of unknown function DUF1328 GB:PROTEIN_ID ABA57005.1 GB:DB_XREF GI:76882324 InterPro:IPR009760 LENGTH 56 SQ:AASEQ MFGWAVTFLIIALIAALFGFTGLAGVATHIAWILFVVGLILFVVFLLLGRRGRPPL GT:EXON 1|1-56:0| SW:ID Y482_NITOC SW:DE RecName: Full=UPF0391 membrane protein Noc_0482; SW:GN OrderedLocusNames=Noc_0482; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->32|Y482_NITOC|1e-14|100.0|32/56| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 2 TM:REGION 2->24| TM:REGION 28->49| SEG 33->55|ilfvvglilfvvflllgrrgrpp| HM:PFM:NREP 1 HM:PFM:REP 6->44|PF07043|8.1e-17|56.4|39/39|DUF1328| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 53-56| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //