[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57009.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  84/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.41.1
:158 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   29->93 3htrB PDBj 4e-11 40.6 %
:RPS:PDB   26->140 3bl4B PDBj 2e-20 10.9 %
:RPS:SCOP  30->94 1pm3A  b.41.1.2 * 5e-11 23.7 %
:HMM:SCOP  6->149 1dxrH1 b.41.1.1 * 1.1e-25 27.9 %
:RPS:PFM   32->91 PF05239 * PRC 5e-09 36.7 %
:HMM:PFM   31->105 PF05239 * PRC 7.2e-19 36.5 74/79  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57009.1 GT:GENE ABA57009.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(520821..521297) GB:FROM 520821 GB:TO 521297 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57009.1 GB:DB_XREF GI:76882328 InterPro:IPR007903 LENGTH 158 SQ:AASEQ MNTPITTPGSDQPRVIGGEDNTSGPGPYLMTANSLENNEVFNLEGEELGKIKDIMIDVPKGRVAYAVLSFGGILGVGDKLFAVPWSALTLDADEKCFVLRVNKEVLENDPGFDKDHWPSMADQRWASDVHSRYGARPYWVPKDYWPTKRVRQGRQTRM GT:EXON 1|1-158:0| TM:NTM 1 TM:REGION 64->86| BL:PDB:NREP 1 BL:PDB:REP 29->93|3htrB|4e-11|40.6|64/88| RP:PDB:NREP 1 RP:PDB:REP 26->140|3bl4B|2e-20|10.9|101/109| RP:PFM:NREP 1 RP:PFM:REP 32->91|PF05239|5e-09|36.7|60/77|PRC| HM:PFM:NREP 1 HM:PFM:REP 31->105|PF05239|7.2e-19|36.5|74/79|PRC| RP:SCP:NREP 1 RP:SCP:REP 30->94|1pm3A|5e-11|23.7|59/69|b.41.1.2| HM:SCP:REP 6->149|1dxrH1|1.1e-25|27.9|136/222|b.41.1.1|1/1|PRC-barrel domain| OP:NHOMO 147 OP:NHOMOORG 88 OP:PATTERN ----------------------------------------------4---332--------------- ----------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------112--92111111------------32432521-1---1--11-1111121-1----1111------------11-----------------------------------1-11--1--12331321----22331111--1222221--11------1---1----1-------------1322-------------------------------------------------------------1---1----------------1----1-----2------------------------------------------------------------------------------------------------------------------------------------------------------------2-11-2----------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 65.8 SQ:SECSTR #########################TTccEEEEccccccccHHHHHHHHHHHHHHTTccccEEEcccHHHHHHcGGHHHHHHcccccccEEEEcccGGGHHHHHHHHHHTTcccc###########EEEEccHHHHHHHH################## DISOP:02AL 8-22, 145-158| PSIPRED cccccccccccccccccccccccccccccccHHHcccccccccccccccEEEEEEEEcccccEEEEEEEcccccccccEEEEEcHHHEEEEccccEEEEcccHHHHHcccccccccccccccHHHHHHHHHHcccccccccccccccccEEccccccc //