[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57014.1
DDBJ      :             Protein of unknown function UPF0118
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  264/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:359 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   236->344 PF01594 * UPF0118 2e-06 26.6 %
:HMM:PFM   15->347 PF01594 * UPF0118 8.2e-52 24.4 324/327  
:BLT:SWISS 195->351 Y1101_MYCTU 1e-14 26.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57014.1 GT:GENE ABA57014.1 GT:PRODUCT Protein of unknown function UPF0118 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 528860..529939 GB:FROM 528860 GB:TO 529939 GB:DIRECTION + GB:PRODUCT Protein of unknown function UPF0118 GB:PROTEIN_ID ABA57014.1 GB:DB_XREF GI:76882333 InterPro:IPR002549 LENGTH 359 SQ:AASEQ MIQLDEAQNRYRKNFIMILLVSILAVFLVMIHEYLIAILLAIIFTALLYPVYAWILKKFNGRQVLSSMTTILLAILMIGLPLLGLLGAVAAEAIQISNSIAPWIEKKIPDQNASPLHEFPQWLPFADQLEPYRTRILAKVGEFAGNAGAFIASGISKATQGTIGFIVNFFIMLYAMFFFFIWGPDSLINLIRYLPLTEKDRSHILEKGLSVTKATLKSILIIGVLQGILVGLAFWVAGIKGAIFWGTITVVLSAVPGLGAPVVWIPAVIYLIATDQIGWAIGMTLWGIIIVGLVDNILRPRIVGSEAKMPDLLILLATLGGILMFGMVGVIVGPIIAALLITVLDIYGKVFTNLYSQAE GT:EXON 1|1-359:0| BL:SWS:NREP 1 BL:SWS:REP 195->351|Y1101_MYCTU|1e-14|26.8|157/385| TM:NTM 7 TM:REGION 24->46| TM:REGION 69->91| TM:REGION 161->183| TM:REGION 217->239| TM:REGION 250->272| TM:REGION 277->299| TM:REGION 318->340| SEG 35->48|liaillaiiftall| SEG 71->94|illailmiglpllgllgavaaeai| SEG 169->181|ffimlyamffffi| SEG 219->232|iliigvlqgilvgl| SEG 312->323|llillatlggil| RP:PFM:NREP 1 RP:PFM:REP 236->344|PF01594|2e-06|26.6|109/328|UPF0118| HM:PFM:NREP 1 HM:PFM:REP 15->347|PF01594|8.2e-52|24.4|324/327|UPF0118| OP:NHOMO 313 OP:NHOMOORG 275 OP:PATTERN ------------------------1-----1--------1-1-------1--1----2-11----1-- -1------------1--11-1---1-111111-111-------------------------------------------------11111---------2-----1-1-1---------------111111111-1------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------12---11111111111111-1---------11-111111121113311--1--21111------------11---1-------------------------------1-1--2222211111112222111-2222-11111--2---1---11111-11111111--1----------1-1--21111111212211---1111-2----1111-----------1--1----------11--1-1--1----1111--11111-11-1-----1---------1111-111111111111-1111111111111-1111111111-----1-------------11111111---------------------------111-----------------11111111111111112122222221122----------11111111111111------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 358-359| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //