[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57015.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->91 PF09606 * Med15 0.00079 18.8 80/799  
:BLT:SWISS 28->95 RPTN_MOUSE 4e-08 33.8 %
:TM
:REPEAT 6|27->36|38->47|49->59|61->70|72->81|83->92

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57015.1 GT:GENE ABA57015.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 530224..530535 GB:FROM 530224 GB:TO 530535 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57015.1 GB:DB_XREF GI:76882334 LENGTH 103 SQ:AASEQ MKKINSLLISAVALSLMLASTVLSAEQHKGMEGMDKGQHKGMEGMDKGQQHKGMEGMDKGQHKGMEGMDKGQHKGMEGMDKGQHKGMEGQEEPTSRSRGNYPD GT:EXON 1|1-103:0| BL:SWS:NREP 1 BL:SWS:REP 28->95|RPTN_MOUSE|4e-08|33.8|68/1130| TM:NTM 1 TM:REGION 4->26| NREPEAT 1 REPEAT 6|27->36|38->47|49->59|61->70|72->81|83->92| HM:PFM:NREP 1 HM:PFM:REP 12->91|PF09606|0.00079|18.8|80/799|Med15| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 24-103| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHccccccHHHHHHHcccccHHHHHcccccHHHHHHHHHHHHHHHccccccccccccc //