[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57018.1
DDBJ      :             D-lactate dehydrogenase (cytochrome)
Swiss-Prot:             

Homologs  Archaea  42/68 : Bacteria  659/915 : Eukaryota  188/199 : Viruses  0/175   --->[See Alignment]
d.145.1d.58.32
:496 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   53->232 2uuvD PDBj 1e-18 28.5 %
:RPS:PDB   20->470 2bvfA PDBj 4e-84 17.3 %
:RPS:SCOP  17->228 1ahuA2  d.145.1.1 * 1e-39 18.4 %
:RPS:SCOP  261->474 1f0xA1  d.58.32.2 * 1e-40 15.9 %
:HMM:SCOP  15->228 1f0xA2 d.145.1.1 * 3.3e-70 45.5 %
:HMM:SCOP  201->471 1w1oA1 d.58.32.4 * 5.3e-78 43.9 %
:RPS:PFM   56->192 PF01565 * FAD_binding_4 1e-22 41.2 %
:RPS:PFM   228->467 PF02913 * FAD-oxidase_C 4e-45 41.7 %
:HMM:PFM   227->467 PF02913 * FAD-oxidase_C 5.2e-67 37.3 241/249  
:HMM:PFM   55->191 PF01565 * FAD_binding_4 2.1e-41 40.7 135/138  
:BLT:SWISS 31->496 GLCD_ECOLI 0.0 66.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57018.1 GT:GENE ABA57018.1 GT:PRODUCT D-lactate dehydrogenase (cytochrome) GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 533278..534768 GB:FROM 533278 GB:TO 534768 GB:DIRECTION + GB:PRODUCT D-lactate dehydrogenase (cytochrome) GB:PROTEIN_ID ABA57018.1 GB:DB_XREF GI:76882337 InterPro:IPR004113 InterPro:IPR006094 LENGTH 496 SQ:AASEQ MSSPTHETFAHSIPKGKLVKAFSAFLSPETILFEEEDLRPYECDGLSAYRVLPWMVVLPETVEQVQKILQICHSWDIPVVARGAGTGLSGGALPLKNGVLLSLAKFNRILAIDPISRTARVQPGVRNLAISEAAAPAGLYYAPDPSSQIACTIGGNVAENSGGVHCLKYGLTVHNILGLKMLTMTGEEISLGGETLDSPGYDLLALMTGSEGLLGVIIEVTVRLLPLPERAQVILAAFDNVAKAGAAVGGIISAGIIPGGLEMMDNLAIRAAEDFVHAGYPQEAAAILLCELDGTQAEVSHQIRKVRELLLSHGAIEIRTALDEQERAKLWQGRKAAFPAVGRLAPDYYCMDGTIPRNRLPQVLERINELSQEFNLPVANVFHAGDGNLHPLILYDANRPGELERAEQLGANILELCVAVGGTITGEHGVGIEKINQMCIQFGTAELQQFHALKAAFDPKGLLNPGKAVPTLHRCAEFGAMHVHQGKLPFPELDRF GT:EXON 1|1-496:0| BL:SWS:NREP 1 BL:SWS:REP 31->496|GLCD_ECOLI|0.0|66.7|466/499| SEG 244->260|agaavggiisagiipgg| BL:PDB:NREP 1 BL:PDB:REP 53->232|2uuvD|1e-18|28.5|172/528| RP:PDB:NREP 1 RP:PDB:REP 20->470|2bvfA|4e-84|17.3|433/453| RP:PFM:NREP 2 RP:PFM:REP 56->192|PF01565|1e-22|41.2|136/139|FAD_binding_4| RP:PFM:REP 228->467|PF02913|4e-45|41.7|240/242|FAD-oxidase_C| HM:PFM:NREP 2 HM:PFM:REP 227->467|PF02913|5.2e-67|37.3|241/249|FAD-oxidase_C| HM:PFM:REP 55->191|PF01565|2.1e-41|40.7|135/138|FAD_binding_4| GO:PFM:NREP 4 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF01565|IPR006094| GO:PFM GO:0050660|"GO:FAD binding"|PF01565|IPR006094| GO:PFM GO:0003824|"GO:catalytic activity"|PF02913|IPR004113| GO:PFM GO:0050660|"GO:FAD binding"|PF02913|IPR004113| RP:SCP:NREP 2 RP:SCP:REP 17->228|1ahuA2|1e-39|18.4|212/268|d.145.1.1| RP:SCP:REP 261->474|1f0xA1|1e-40|15.9|195/237|d.58.32.2| HM:SCP:REP 15->228|1f0xA2|3.3e-70|45.5|211/0|d.145.1.1|1/1|FAD-binding domain| HM:SCP:REP 201->471|1w1oA1|5.3e-78|43.9|262/0|d.58.32.4|1/1|FAD-linked oxidases, C-terminal domain| OP:NHOMO 2558 OP:NHOMOORG 889 OP:PATTERN 11-1-143234333331122221331111122----------------13221-------12113-11 123451-1111-2-33333-332246434443333338C7145432121111143312--33524685531--------1-141111111---1-------211121212---------------2122222221265555---232422443331111121323233333-1--1--1----22233--131122222222223222353112122234413--------31-----------------------1111----11--21------------------------------------------------------4-121111111212-122211131-1-1--2-461121--52--1--1-322311411111338662255664544444443445-44743A4845417444458546876422145544562442222222242221325-----------------------------114611755567557573555577975555449678A892455376544958568446322135222222242346514824345453555-322112222654646232--1122112112111111111111441-1-41213-22222211322222223232---5334------21111113213334333-233334333323333333112111111111111111111111121121111--111111111111---1--111-11132455111111-111111111111111252416666475444446434421111211111112222221122222222222232222112-221122--------1-1--------------------------11---2---421 ----332-741-2422454453455543333333333433333233445456684334355423324334224243313334446312-47443323332322433-323733353331-1332842528M5-4351211322311313131-33351569434322424335342332X2322231173312366532 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 495 STR:RPRED 99.8 SQ:SECSTR ccccTTccHccHHHHHHHHcccccccccEEEcTTcTTHHHHHccccTTccccccEEEEcccHHHHHHHHHHHHHHTccEEEEcccccTTcTTccccccEEEEcTTcccEEEEETTTTEEEEETTccHHHHHHHHHTTTEEEcccccTccTccHHHHHTTccccTTHHHHccGGGGEEEEEEEcTTccEEEEEGGGTccccHHHHHHHHHHGGGTcEEEEEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHTTTTcccEEEEEEcTTccEcccEEEEEEEccccHHHHHHHHHHHHTTccccEEccEEEcHHHHHHHHHHHcccccccEHHHHHHHHHTTGGGcEEETTTTEEEEEEEEccccccTTccccccccccEEEEEEEEcTTcTTTTHHHHHHHHHTTcEEEEEccGGGcccccHHHHHHHTcHHcHHHHHHHHHHHHHHcTTccccccccccccTTccHGcccccccEEEEEccccH# DISOP:02AL 1-16, 492-493| PSIPRED ccccccccccccccHHHHHHHHHHHcccccEEccHHHHHHHHccccccccccEEEEEEEccHHHHHHHHHHHHHcccEEEEEEcccccccccccccccEEEEHHHcccEEEEEccccEEEEEccccHHHHHHHHHHcccEEEcccccccccccccccccccccccccccccHHEEEEEEEEEcccccEEEEcccccccccHHHHHHHHcccccEEEEEEEEEEEEEcccEEEEEEEEEccHHHHHHHHHHHHHHHccccHHHHccHHHHHHHHHHHccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHHHHHccccEEEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHccEEEEcccccHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccc //