[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57044.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:123 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   59->119 PF04893 * Yip1 4.2e-05 27.9 61/173  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57044.1 GT:GENE ABA57044.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 565502..565873 GB:FROM 565502 GB:TO 565873 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57044.1 GB:DB_XREF GI:76882363 LENGTH 123 SQ:AASEQ MRGVIITALLTLIFLFWLAGGLYGFLKTKNKSPEAKRTVAYILGYPLLAVYVASDGLPPAAIVFPVGLGGVFWLLAGMHLQKVLEGEYPPTPGTFIGLSIKYCLGGVLGAFLLGALLQYAGLF GT:EXON 1|1-123:0| TM:NTM 4 TM:REGION 4->26| TM:REGION 38->60| TM:REGION 62->84| TM:REGION 96->118| SEG 6->19|italltliflfwla| SEG 104->122|lggvlgafllgallqyagl| HM:PFM:NREP 1 HM:PFM:REP 59->119|PF04893|4.2e-05|27.9|61/173|Yip1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39,45-46,48-48,53-53,101-102,104-104,109-109| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccc //