Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57049.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:215 amino acids
:RPS:PDB   28->135 1dljA PDBj 3e-04 11.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57049.1 GT:GENE ABA57049.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 568010..568657 GB:FROM 568010 GB:TO 568657 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57049.1 GB:DB_XREF GI:76882368 LENGTH 215 SQ:AASEQ MAFYDELNDESNFVASFTSNSKGDFGVFAKGYRLGAERLAESLTSAHRFADYEAYPVVFLYRHALELSLKHIIYSAALISAFQFSPSADGRLKNDHRLPPLASGVAQVLELLFPKEGSLGLLMREISEICDDWRNLDPHSYAYRYPIDIQGKPSTRQHQVVNLRSLAFRMSTVLESLETVHFGLNIETDKAQEIYETVQQIIVSISHPTDTESEG GT:EXON 1|1-215:0| RP:PDB:NREP 1 RP:PDB:REP 28->135|1dljA|3e-04|11.7|103/402| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 47.9 SQ:SECSTR ###########################HHHHTTccHHHHHHHHHTTTccccccccc#####cccccHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHHHTTccccccEEEEEcccccTTccccTT################################################################################ DISOP:02AL 207-215| PSIPRED cccHHHHccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHHcHHHccccccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc //