[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57053.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.17
:156 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   14->51 3cjkA PDBj 4e-04 28.9 %
:RPS:PDB   93->155 1cpzA PDBj 3e-06 27.9 %
:RPS:SCOP  93->153 1sb6A  d.58.17.1 * 1e-06 23.7 %
:HMM:SCOP  8->68 1fe0A_ d.58.17.1 * 7.5e-07 32.2 %
:HMM:SCOP  81->155 1q8lA_ d.58.17.1 * 3.8e-05 27.4 %
:HMM:PFM   16->52 PF00403 * HMA 5.2e-06 29.7 37/62  
:HMM:PFM   95->151 PF00403 * HMA 0.00088 27.3 55/62  
:BLT:SWISS 16->154 ATCU_SINMW 7e-05 34.5 %
:REPEAT 2|9->48|93->131
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57053.1 GT:GENE ABA57053.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 571845..572315 GB:FROM 571845 GB:TO 572315 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57053.1 GB:DB_XREF GI:76882372 LENGTH 156 SQ:AASEQ MSSHSGVQVKLADVHLCCQGCVDAVNTALMSVDGVDSGCDREKGTVTFTANDATTARMALDALAAAGFYGKSDNTQLTMRAVGDLPEGKVNSLKVSGIHNCCAPCCEAIKGAIATVDGVSGDTAKPRATTFEVTGNFSAAALIKAFNAAGFSARVE GT:EXON 1|1-156:0| BL:SWS:NREP 1 BL:SWS:REP 16->154|ATCU_SINMW|7e-05|34.5|116/827| NREPEAT 1 REPEAT 2|9->48|93->131| SEG 52->66|dattarmaldalaaa| RP:PDB:NREP 2 RP:PDB:REP 14->51|3cjkA|4e-04|28.9|38/68| RP:PDB:REP 93->155|1cpzA|3e-06|27.9|61/68| HM:PFM:NREP 2 HM:PFM:REP 16->52|PF00403|5.2e-06|29.7|37/62|HMA| HM:PFM:REP 95->151|PF00403|0.00088|27.3|55/62|HMA| RP:SCP:NREP 1 RP:SCP:REP 93->153|1sb6A|1e-06|23.7|59/64|d.58.17.1| HM:SCP:REP 8->68|1fe0A_|7.5e-07|32.2|59/0|d.58.17.1|1/2|HMA, heavy metal-associated domain| HM:SCP:REP 81->155|1q8lA_|3.8e-05|27.4|73/0|d.58.17.1|2/2|HMA, heavy metal-associated domain| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 70.5 SQ:SECSTR ##cccccEEEEEEEccccHHHHHHHHHHHHHHccEEEEEETTTTEEEEEEc#########################################EEEcccc##cccHHHHHHHHHHTcTTEEEETTTTEEEEEEcTTTccHHHHHHHHHTTcccEEE# DISOP:02AL 1-8, 154-156| PSIPRED cccccccEEEEEEEEEEHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccHHHHHHHHHHccccccccccHHHHHHccccccccEEEEEEccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccccc //