[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57062.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:239 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   155->196 PF03595 * C4dic_mal_tran 4e-06 42.9 %
:HMM:PFM   12->196 PF03595 * C4dic_mal_tran 6.3e-33 26.6 177/287  
:BLT:SWISS 4->210 Y576_METJA 4e-14 29.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57062.1 GT:GENE ABA57062.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(582318..583037) GB:FROM 582318 GB:TO 583037 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57062.1 GB:DB_XREF GI:76882381 LENGTH 239 SQ:AASEQ MFPLGLFSFDPHLGHLLALISYSFSVSQTIEITQANGAWLLPPAGLFVNIFAGNFLIAHFPDFIGHSLLIFHVFALGIAFFSYFLMLSLLFHQLYCCPPPLREMAPALAVPLAPPGVSVIALLSLEKALDHFPQLDSLQNNLSPFIHVYVPFVIGYGCFWAILAALIMVRYVKEKNIPFTLGFWAFVFPIAAFGIAIFLTAQNPLFSFLNGVAIFLWGISLLLWGFTTYQNLLRFLPRN GT:EXON 1|1-239:0| BL:SWS:NREP 1 BL:SWS:REP 4->210|Y576_METJA|4e-14|29.0|186/347| TM:NTM 6 TM:REGION 39->61| TM:REGION 71->93| TM:REGION 103->125| TM:REGION 145->167| TM:REGION 178->200| TM:REGION 206->228| SEG 80->91|ffsyflmlsllf| SEG 105->115|apalavplapp| RP:PFM:NREP 1 RP:PFM:REP 155->196|PF03595|4e-06|42.9|42/287|C4dic_mal_tran| HM:PFM:NREP 1 HM:PFM:REP 12->196|PF03595|6.3e-33|26.6|177/287|C4dic_mal_tran| GO:PFM:NREP 2 GO:PFM GO:0016021|"GO:integral to membrane"|PF03595|IPR004695| GO:PFM GO:0055085|"GO:transmembrane transport"|PF03595|IPR004695| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -----------------------------------1------------------1--1---------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-17,20-20,25-26,31-32,34-34,59-60,62-62,67-68,73-74,76-76,81-81,101-101,109-109,115-115,118-118,123-123,185-186,188-188,193-193,207-207| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHEEEEEEccccEEcccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHccHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc //