[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57071.1
DDBJ      :             DSBA oxidoreductase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  272/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:220 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   34->209 3hd5C PDBj 1e-25 38.0 %
:RPS:PDB   27->204 1bedA PDBj 1e-24 30.5 %
:RPS:SCOP  47->204 1a2jA  c.47.1.13 * 4e-11 19.6 %
:HMM:SCOP  26->207 1fvkA_ c.47.1.13 * 3.1e-42 35.0 %
:RPS:PFM   50->183 PF01323 * DSBA 2e-10 36.8 %
:HMM:PFM   84->197 PF01323 * DSBA 1.5e-16 28.4 109/193  
:HMM:PFM   59->104 PF06110 * DUF953 1.5e-07 37.0 46/119  
:HMM:PFM   43->62 PF06053 * DUF929 0.00049 35.0 20/249  
:BLT:SWISS 22->214 DSBA_PSEAE 9e-51 44.6 %
:PROS 51->69|PS00194|THIOREDOXIN_1
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57071.1 GT:GENE ABA57071.1 GT:PRODUCT DSBA oxidoreductase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(595232..595894) GB:FROM 595232 GB:TO 595894 GB:DIRECTION - GB:PRODUCT DSBA oxidoreductase GB:PROTEIN_ID ABA57071.1 GB:DB_XREF GI:76882390 InterPro:IPR001853 InterPro:IPR006662 InterPro:IPR006663 LENGTH 220 SQ:AASEQ MLRFVSGLLLSFSLLLISPLGAAAEPAFTEGVHYKAVSPPLHAMEPGEAEVLEIFWYGCPHCYRFEPILEQWAENKPEDVAFIRVPAIFRDSWQLHAQAFYTAEALGVLDKVHRPLFDAMNLERRQFKTKEALADFFATLGVPKEDFLPTFDSFAVQGKVQQAIATTRASGITGVPAIVINGKYRTDANMAGGFEQMLEVADYLTDQGKTSSEQTATTTE GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 22->214|DSBA_PSEAE|9e-51|44.6|193/211| PROS 51->69|PS00194|THIOREDOXIN_1|PDOC00172| TM:NTM 1 TM:REGION 1->23| SEG 6->20|sglllsfslllispl| BL:PDB:NREP 1 BL:PDB:REP 34->209|3hd5C|1e-25|38.0|171/176| RP:PDB:NREP 1 RP:PDB:REP 27->204|1bedA|1e-24|30.5|174/181| RP:PFM:NREP 1 RP:PFM:REP 50->183|PF01323|2e-10|36.8|133/178|DSBA| HM:PFM:NREP 3 HM:PFM:REP 84->197|PF01323|1.5e-16|28.4|109/193|DSBA| HM:PFM:REP 59->104|PF06110|1.5e-07|37.0|46/119|DUF953| HM:PFM:REP 43->62|PF06053|0.00049|35.0|20/249|DUF929| GO:PFM:NREP 2 GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF01323|IPR001853| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF01323|IPR001853| RP:SCP:NREP 1 RP:SCP:REP 47->204|1a2jA|4e-11|19.6|158/188|c.47.1.13| HM:SCP:REP 26->207|1fvkA_|3.1e-42|35.0|177/188|c.47.1.13|1/1|Thioredoxin-like| OP:NHOMO 337 OP:NHOMOORG 273 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111111111111111111111111111112111211111111111111112233333111111---------------------------------1-------------------------111111111232222211322222233222--111-1------11112111111111111-11111111111111-11111111111111111111111-1-11111111111-111111111111-111-----11111111111111212221111111111111112111111111111111111---------11221111112222222223221222222111-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 189 STR:RPRED 85.9 SQ:SECSTR #########################cccccTTTEEEcccccccccTTccEEEEEEcTTcHHHHHHHHHHHHHHHTccTTcEEEEcccccGGGHHHHHHHHHHHHHTTcHHHHHHHHHHHHTTcccccccHHHHHHHHHTTTccHHHHHHHHTcHHHHHHHHHHHHHHHHHTcccccEEEETTTEEEcGGGcccHHHHHHHHHHHHHHHHHHHcc###### DISOP:02AL 1-2, 208-220| PSIPRED cHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEcccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEEEEEEccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccHHHHHHHHHHHHHHHHHcccccEEEEEccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHccc //