[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57088.1
DDBJ      :             Protein of unknown function DUF891
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  107/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:86 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   29->72 PF05973 * Gp49 4e-04 55.8 %
:HMM:PFM   16->83 PF05973 * Gp49 5.6e-20 43.9 66/91  
:BLT:SWISS 19->86 Y1419_HAEIN 7e-17 55.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57088.1 GT:GENE ABA57088.1 GT:PRODUCT Protein of unknown function DUF891 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 616295..616555 GB:FROM 616295 GB:TO 616555 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF891 GB:PROTEIN_ID ABA57088.1 GB:DB_XREF GI:76882407 InterPro:IPR009241 LENGTH 86 SQ:AASEQ MPSGSMVYAISKPELVLVRVERLAAGNSGDVKPVGEGVSELRIDYGPGYRVYYKKQGKKVIILLAGGDKRSQASDIKTALRLARNL GT:EXON 1|1-86:0| BL:SWS:NREP 1 BL:SWS:REP 19->86|Y1419_HAEIN|7e-17|55.9|68/100| RP:PFM:NREP 1 RP:PFM:REP 29->72|PF05973|4e-04|55.8|43/92|Gp49| HM:PFM:NREP 1 HM:PFM:REP 16->83|PF05973|5.6e-20|43.9|66/91|Gp49| OP:NHOMO 150 OP:NHOMOORG 107 OP:PATTERN -------------------------------------------------------------------- 1------1--------------------------------------------------------------------1-----------------------------------------------1--11-1211------------51---11-----------1---1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-131-4--------111-1------------1---2131------------1--1-------------------------1----2----------------------------------------213222-111-111-2---2-2121-1-----1---2-12--1---1-------------1--3-----2--11-1-1-----111---1----------------------------------1----1--1-------------------------3--1-----------11----------------------------------1-32-----------------------------1-11-1-----2-----------------11----1--1-2-----------21--1-112---11--11------------------------111--------42-2----------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEcccEEEEEEEEccEEEEEEEccccHHHHHHHHHHHHHHHcc //