[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57093.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  10/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:65 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   1->50 PF10049 * DUF2283 6.1e-23 40.0 50/50  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57093.1 GT:GENE ABA57093.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 618416..618613 GB:FROM 618416 GB:TO 618613 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57093.1 GB:DB_XREF GI:76882412 LENGTH 65 SQ:AASEQ MKVSYFEDTDTLYIEFRDNDIAESKDLDENTILDVDANGNVCAITFEHASQRTDVSRLIVEGIAA GT:EXON 1|1-65:0| HM:PFM:NREP 1 HM:PFM:REP 1->50|PF10049|6.1e-23|40.0|50/50|DUF2283| OP:NHOMO 11 OP:NHOMOORG 10 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------11---1-------------1----1----------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------2--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 64-66| PSIPRED ccEEEcccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEEEEHHccccccEEEEEEEEc //