[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57103.1
DDBJ      :             extracellular solute-binding protein, family 1
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  352/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:268 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->260 1twyF PDBj 6e-27 35.0 %
:RPS:PDB   27->266 2capA PDBj 1e-27 19.6 %
:RPS:SCOP  27->268 1a40A  c.94.1.1 * 1e-34 24.9 %
:HMM:SCOP  17->267 1pc3A_ c.94.1.1 * 5.6e-56 37.1 %
:HMM:PFM   23->106 PF03466 * LysR_substrate 4.2e-07 20.7 82/209  
:BLT:SWISS 27->257 PSTS1_STRR6 5e-24 31.8 %
:PROS 2->31|PS00475|RIBOSOMAL_L15
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57103.1 GT:GENE ABA57103.1 GT:PRODUCT extracellular solute-binding protein, family 1 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(628921..629727) GB:FROM 628921 GB:TO 629727 GB:DIRECTION - GB:PRODUCT extracellular solute-binding protein, family 1 GB:PROTEIN_ID ABA57103.1 GB:DB_XREF GI:76882422 InterPro:IPR006059 LENGTH 268 SQ:AASEQ MRVLLKTLLLSFTLTAALLSQAADNRLTLTGSSTVAPLASEIAKRFESKHPGVRIDVQMGGSSRGINDARMGLADIGMVSRALKPTEQDLSAFLIAMDGIGLILHKSNAVNTLSNTQIIDIYIGKITHWKQVGGPDLPITVVNKAEGRSTLELFLHYFALKNSQIKAHVVVGDNQQGIKTVSGNPGAIGYVSIGTAEYEEDRGTPIKLLPMAGQPATVEAVAKGGYPLSRPLNLVIKKTRSGLVKDFIAFAQSAEVKNLVEAQFFVAP GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 27->257|PSTS1_STRR6|5e-24|31.8|223/292| PROS 2->31|PS00475|RIBOSOMAL_L15|PDOC00386| SEG 4->23|llktlllsftltaallsqaa| BL:PDB:NREP 1 BL:PDB:REP 25->260|1twyF|6e-27|35.0|226/241| RP:PDB:NREP 1 RP:PDB:REP 27->266|2capA|1e-27|19.6|240/376| HM:PFM:NREP 1 HM:PFM:REP 23->106|PF03466|4.2e-07|20.7|82/209|LysR_substrate| RP:SCP:NREP 1 RP:SCP:REP 27->268|1a40A|1e-34|24.9|241/321|c.94.1.1| HM:SCP:REP 17->267|1pc3A_|5.6e-56|37.1|251/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 542 OP:NHOMOORG 374 OP:PATTERN ----------------------------12--112--22111211112211121-------------- ------------------------------------1----1-1----------------1-------2----------111------221111--------1---11-----------------22-22123321111121112152431141111------11142361---------------1111---12222212212221121-1111222121-1-111111112-11111111111111-111-21212211111221122211222222222222211122222222222111111111111111111111122111112122221211111-22221111311111-321-2-1111121----1------------1-----------------------1--1-------------------1-----------1---------1----1------------------------------------1--------------------------------1-2---1------1-----1-----1--------------2311-1122122111313--31311111-25---------------------1-----1----11---2-11111-21111-122121---1--1--------------------------------------------------------------------------------------------1-----------2---------------------------2111-1--12221212111----------13332222212233----------------11111-1111111111----------------------------1111111111-21 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 244 STR:RPRED 91.0 SQ:SECSTR ########################cEccEEEccTTHHHHTcTTTccTTcccHHHHHHHHHTcGGGTcccTTccccEEEEcccccHHHccEEEEEEEEEEcccccccccccccEEcHHHHHHHHTccccGGGccccccccEEEEEccccHHHHHHHHHHHHHcccccccccccHHHHHHHcTTccccEEccccHHHHcccGGGGGcTTTccEEccETTEEEccccccccEEEEEEEEEcHHHHHHHHHHHTccccccHHHHHHTTcccc DISOP:02AL 1-2| PSIPRED cHHHHHHHHHHHHHHHHHcccccccEEEEEEHHHHHHHHHHHHHHHHHHcccEEEEEEEEcHHHHHHHHHcccccEEEccccccHHHcccEEEEEEEccEEEEEccccccccccHHHHHHHHcccccccccccccccEEEEEccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHcccccEEEEEHHHHHHHHHccccEEEEccccccccHHHHHcccccEEEEEEEEEcccccHHHHHHHHHHccHHHHHHHHHcccccc //