[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57120.1
DDBJ      :             Small multidrug resistance protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  412/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.39.1
:109 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->106 1s7bB PDBj 2e-23 46.2 %
:RPS:SCOP  4->82 1s7bA  f.39.1.1 * 6e-04 54.4 %
:HMM:SCOP  4->109 1s7bA_ f.39.1.1 * 8.7e-17 35.8 %
:RPS:PFM   3->82 PF00893 * Multi_Drug_Res 2e-14 55.0 %
:HMM:PFM   1->93 PF00893 * Multi_Drug_Res 3e-34 55.9 93/93  
:BLT:SWISS 3->83 QACE_KLEAE 7e-30 66.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57120.1 GT:GENE ABA57120.1 GT:PRODUCT Small multidrug resistance protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(648698..649027) GB:FROM 648698 GB:TO 649027 GB:DIRECTION - GB:PRODUCT Small multidrug resistance protein GB:PROTEIN_ID ABA57120.1 GB:DB_XREF GI:76882439 InterPro:IPR000390 LENGTH 109 SQ:AASEQ MQWIFLSLAILAEVIATSSLKAAAGFTRLGPSLAVILGYGAAFYFLSLTLRTLPVGVAYAVWSGVGVALITLVAWLFYGQTLDTPALLGLALIIAGVVVLNVFSKSIAP GT:EXON 1|1-109:0| BL:SWS:NREP 1 BL:SWS:REP 3->83|QACE_KLEAE|7e-30|66.7|81/110| TM:NTM 4 TM:REGION 1->23| TM:REGION 29->51| TM:REGION 57->79| TM:REGION 86->108| SEG 86->100|allglaliiagvvvl| BL:PDB:NREP 1 BL:PDB:REP 3->106|1s7bB|2e-23|46.2|104/107| RP:PFM:NREP 1 RP:PFM:REP 3->82|PF00893|2e-14|55.0|80/93|Multi_Drug_Res| HM:PFM:NREP 1 HM:PFM:REP 1->93|PF00893|3e-34|55.9|93/93|Multi_Drug_Res| GO:PFM:NREP 1 GO:PFM GO:0016021|"GO:integral to membrane"|PF00893|IPR000390| RP:SCP:NREP 1 RP:SCP:REP 4->82|1s7bA|6e-04|54.4|79/106|f.39.1.1| HM:SCP:REP 4->109|1s7bA_|8.7e-17|35.8|106/106|f.39.1.1|1/1|Multidrug resistance efflux transporter EmrE| OP:NHOMO 672 OP:NHOMOORG 420 OP:PATTERN ------------------------1--1---------------------1111--------------- -1--2----------2211-1111121111112---1111--1-11-----------1----1-311--11---------1-1-----------------11-------1--------------111211-1121-11111----------------111111---1111----------------11---112333332322233223-133233121112112-----11---------------------1-1-11-----11------1---111-------------------------------------------1----1----------1111---------1----1-12-------------2-----1-----1-2--1123222111111111112-11--1-12----111-1121112222-1-1122222111222222221---1-21--------------11----1----1-1-1--2-1211122222222222222122222222223221-----1-1112-------2-2-11---11--------211-----111111-1-----1--11--11-1--------------------------1131-11---311------21-----112-21---2----------2112222222244322-312311213332122222223-323242212232232222225211122222123323332333311---1-------111-2111--11------1-223261-1111144342121111132122-----1----122-111113-1--2212121111-------------------------------------------------------------1- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 104 STR:RPRED 95.4 SQ:SECSTR ##cHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHTccccccccccHHHHHHHHHHHHHTTTTTccccccccHHHHHHHHHHHHHHHHHHHH### DISOP:02AL 107-109| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccc //