[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57129.1
DDBJ      :             TonB-like protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  72/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.212.1
:217 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   132->217 2k9kA PDBj 9e-19 41.9 %
:RPS:SCOP  144->215 1ihrA  d.212.1.2 * 2e-15 28.4 %
:HMM:SCOP  128->217 1u07A_ d.212.1.2 * 9.4e-26 47.8 %
:RPS:PFM   139->215 PF03544 * TonB 3e-12 40.3 %
:HMM:PFM   138->215 PF03544 * TonB 2.9e-28 46.2 78/79  
:HMM:PFM   5->92 PF02993 * MCPVI 0.00076 20.5 88/238  
:BLT:SWISS 115->217 TONB_PSEAE 8e-17 38.8 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57129.1 GT:GENE ABA57129.1 GT:PRODUCT TonB-like protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 656088..656741 GB:FROM 656088 GB:TO 656741 GB:DIRECTION + GB:PRODUCT TonB-like protein GB:PROTEIN_ID ABA57129.1 GB:DB_XREF GI:76882448 InterPro:IPR003538 InterPro:IPR006260 LENGTH 217 SQ:AASEQ MRFLIAIAIAGLVNLGLFLLMSFMAAGQQRGPEGIETATMVDFVRLKRESAPPEPKERQLPKKPPPPEEPPSMMMPRPQAPQPKPSALAKVTPHIELPLSLKSDGPYLGDYGQTPGTSLGSGIVPAGEGDLLPLVRISPQYPRRAARRGLEGSVTVAFIITKEGSVRDPKVIESHPSGIFEQAALQAIKRWKFKPKQIEGQLVEQRATQEIEFNLAR GT:EXON 1|1-217:0| BL:SWS:NREP 1 BL:SWS:REP 115->217|TONB_PSEAE|8e-17|38.8|103/342| TM:NTM 1 TM:REGION 4->26| SEG 52->78|ppepkerqlpkkppppeeppsmmmprp| BL:PDB:NREP 1 BL:PDB:REP 132->217|2k9kA|9e-19|41.9|86/106| RP:PFM:NREP 1 RP:PFM:REP 139->215|PF03544|3e-12|40.3|77/79|TonB| HM:PFM:NREP 2 HM:PFM:REP 138->215|PF03544|2.9e-28|46.2|78/79|TonB| HM:PFM:REP 5->92|PF02993|0.00076|20.5|88/238|MCPVI| GO:PFM:NREP 3 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF03544|IPR003538| GO:PFM GO:0006826|"GO:iron ion transport"|PF03544|IPR003538| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF03544|IPR003538| RP:SCP:NREP 1 RP:SCP:REP 144->215|1ihrA|2e-15|28.4|67/73|d.212.1.2| HM:SCP:REP 128->217|1u07A_|9.4e-26|47.8|90/0|d.212.1.2|1/1|TolA/TonB C-terminal domain| OP:NHOMO 143 OP:NHOMOORG 72 OP:PATTERN -------------------------------------------------------------------- -23-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-4------------------------1------------------------------------------------------------------------------------------------------------211-1--1-111---------1--------1---------------------------12-3-34243-4232323233313314223---1-----------------------------------------------------------------------------------------------2---------1--1---------------------------41111-----------------------22222222222222--1-1-----1111---------------------------------------------------------3- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 86 STR:RPRED 39.6 SQ:SECSTR ###################################################################################################################################ccccccccccccHHHHHccccEEEEEEEEETTTEEEEEEEEEEccccccHHHHHHHHHHccccccccccccccEEEEEEEEccccc DISOP:02AL 24-127| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHcccccEEEEEEEEccccEEEEEEEEEccccHHHHHHHHHHHHHccccccccccEEEEEEEEEEEEEEEcc //