[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57135.1
DDBJ      :             phage transcriptional regulator, AlpA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.6.1
:81 amino acids
:PSIPRED
:DISOPRED
:HMM:SCOP  12->64 1j9iA_ a.6.1.5 * 0.00034 25.5 %
:RPS:PFM   13->61 PF05930 * Phage_AlpA 5e-05 36.7 %
:HMM:PFM   13->61 PF05930 * Phage_AlpA 1.7e-18 28.6 49/51  
:BLT:SWISS 25->64 Y9K_BPP4 1e-04 37.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57135.1 GT:GENE ABA57135.1 GT:PRODUCT phage transcriptional regulator, AlpA GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(664804..665049) GB:FROM 664804 GB:TO 665049 GB:DIRECTION - GB:PRODUCT phage transcriptional regulator, AlpA GB:PROTEIN_ID ABA57135.1 GB:DB_XREF GI:76882454 InterPro:IPR010260 LENGTH 81 SQ:AASEQ MDAGSQNRPSKMLINRRTLLAMIPLSDRAIFNMEKRGDFPRRIVLTSRNVAWDLAEVEDWIEARKRTDDQARRPGFTAASR GT:EXON 1|1-81:0| BL:SWS:NREP 1 BL:SWS:REP 25->64|Y9K_BPP4|1e-04|37.5|40/100| RP:PFM:NREP 1 RP:PFM:REP 13->61|PF05930|5e-05|36.7|49/50|Phage_AlpA| HM:PFM:NREP 1 HM:PFM:REP 13->61|PF05930|1.7e-18|28.6|49/51|Phage_AlpA| HM:SCP:REP 12->64|1j9iA_|0.00034|25.5|51/68|a.6.1.5|1/1|Putative DNA-binding domain| OP:NHOMO 31 OP:NHOMOORG 29 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------1-----1-1------1---1-11--------1-1-2-----------1-------------------------------1---------------------------------------------1---------------------1-------111-----------------------2-------------------------------------------------------------------1----------------------------1------------11-----------1---------------------1---------------------------1---------------------------------------------------------------------1----------------------------------1-1-------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-12, 65-81| PSIPRED ccccccccHHHHHHcHHHHHHHccccHHHHHHHHHcccccccEEEccccEEccHHHHHHHHHHHHcccccccccccccccc //