[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57136.1
DDBJ      :             phage lambda repressor protein. Serine peptidase. MEROPS family S24
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  87/915 : Eukaryota  2/199 : Viruses  15/175   --->[See Alignment]
b.87.1
:225 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   99->219 2ho0A PDBj 5e-12 32.2 %
:RPS:PDB   126->220 1ay9A PDBj 2e-17 22.8 %
:RPS:SCOP  126->220 1ay9A  b.87.1.1 * 8e-18 22.8 %
:HMM:SCOP  96->219 1jhfA2 b.87.1.1 * 7.6e-26 39.5 %
:HMM:PFM   140->206 PF00717 * Peptidase_S24 1e-19 37.3 67/70  
:BLT:SWISS 22->223 YMFK_ECOLI 3e-36 41.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57136.1 GT:GENE ABA57136.1 GT:PRODUCT phage lambda repressor protein. Serine peptidase. MEROPS family S24 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(665310..665987) GB:FROM 665310 GB:TO 665987 GB:DIRECTION - GB:PRODUCT phage lambda repressor protein. Serine peptidase. MEROPS family S24 GB:PROTEIN_ID ABA57136.1 GB:DB_XREF GI:76882455 InterPro:IPR006198 LENGTH 225 SQ:AASEQ MTLKHNQIRLHNLEVLITEAGSAAKLARMAGTNSSYLSQVRNQLPTKKGTPRSIGDELAGKLEKAMKKPQGWMDTLPADGTTPQEENNAHDGPDLRSLHPLISWVQAGNWYEVSESFVPAYGSELLPCPVRCSPESFVLRVRGSSMEPKFHEDDLIFVDPNVSADHGKYVVVRLDESNEATFKQLIIEDGKQYLKALNPDWPNRIIEVDEEATICGVIVFKGEVV GT:EXON 1|1-225:0| BL:SWS:NREP 1 BL:SWS:REP 22->223|YMFK_ECOLI|3e-36|41.2|194/224| BL:PDB:NREP 1 BL:PDB:REP 99->219|2ho0A|5e-12|32.2|118/128| RP:PDB:NREP 1 RP:PDB:REP 126->220|1ay9A|2e-17|22.8|92/108| HM:PFM:NREP 1 HM:PFM:REP 140->206|PF00717|1e-19|37.3|67/70|Peptidase_S24| RP:SCP:NREP 1 RP:SCP:REP 126->220|1ay9A|8e-18|22.8|92/108|b.87.1.1| HM:SCP:REP 96->219|1jhfA2|7.6e-26|39.5|119/126|b.87.1.1|1/1|LexA/Signal peptidase| OP:NHOMO 140 OP:NHOMOORG 104 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------2--1-1-1---------1-1--------1------1-------------------------------------------------------1-----------13-------2----------1--1-------1--1--132213-3-112--1-22-1123--11-11-11----1--------1--------111--1---111121111213----11111--1---1-1---------1-1-1--1-31--1-1-------212-12-1-533-----------1-----1-1--------------------2-------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1---------- ------------------------------------------1111-----1-1-----1-------------------------------------1---------------------------------------1------11-1-------11-----1------------ STR:NPRED 202 STR:RPRED 89.8 SQ:SECSTR ###########HHHHHTTTTTccHHHHHHHTccHHHHHHHTTT#######TccccHHHHHHTTTTTTccGGGTcHHHHHHHHHHHHHHHccccccccccccccccccTTTTccccccccccccccccHHcccGGGEEEEEccccTTGGTccTTcEEEEEccccccTTcEEEEEETTTTEEEEEEEEccccccEEEcccTTcccEEccTTccEEEEEEEEE##### DISOP:02AL 1-3, 46-55, 81-91| PSIPRED ccccHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHHHcccHHHHccccccccccccccccHHHccccEEEccccccccccccccccccccccccEEEEccccccccEEEEEEEccccccccccccEEEEEcccccccccEEEEEEEcccEEEEEEEEEEccEEEEEEcccccccEEEcccccEEEEEEEEEEEEEc //