[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57137.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   15->41 PF00631 * G-gamma 0.00014 33.3 27/55  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57137.1 GT:GENE ABA57137.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 666053..666376 GB:FROM 666053 GB:TO 666376 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57137.1 GB:DB_XREF GI:76882456 LENGTH 107 SQ:AASEQ MIRTVLMFLSMELKEFLKVATKRERADVAVACSDSVSYLYQIAGEHRYASPWMATQIERQTRVVADLSDGRLEPVPRASMVRHPEIFYDVGLRENTQETGGDDDGTR GT:EXON 1|1-107:0| HM:PFM:NREP 1 HM:PFM:REP 15->41|PF00631|0.00014|33.3|27/55|G-gamma| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 95-107| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccHHHcccccEEEcccccccccccccccccc //