[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57141.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  41/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:247 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   24->230 PF08900 * DUF1845 1e-39 41.1 %
:HMM:PFM   21->230 PF08900 * DUF1845 3.4e-74 39.5 210/217  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57141.1 GT:GENE ABA57141.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 669914..670657 GB:FROM 669914 GB:TO 670657 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57141.1 GB:DB_XREF GI:76882460 LENGTH 247 SQ:AASEQ MSMTSDAKQFYETVDTHHRDSTPGALRGEVWLTIQTYQAQGLIRGRRAIDGKPAIIGLIGFADRLKSLWQAIRFDDPYADWWLLKVEEGIADSRTQLLTLQQRMEGLVASNGALEFAIAQSSRPQRVSLQFANPYAFRAAQLLGQYDQLMCTDMTLHHLGIDIPGDLVDQVAGCGRWIRRVFALPQGYHCLDIRRADIQKGTPVAVKARERMGEIPDDILCGNRLPSLRPVAFRQIDSRAPVVTGEA GT:EXON 1|1-247:0| RP:PFM:NREP 1 RP:PFM:REP 24->230|PF08900|1e-39|41.1|207/217|DUF1845| HM:PFM:NREP 1 HM:PFM:REP 21->230|PF08900|3.4e-74|39.5|210/217|DUF1845| OP:NHOMO 50 OP:NHOMOORG 41 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------4-----------------------1---1--1---123-1-----1----------------1-2---------------------------------------------------------------1-1-------1--------------------1--1---------11-----------------------------------1--1--1--------------2------------------1--------------------------11----1---------------111-111---11---1--------------------------1-211---1-------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 246-247| PSIPRED ccccHHHHHHHHccccHHHcccccccccEEEEEEEHHHHccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHccHHHHHHHHHcccccHHHHcccccccccccEEEEEcccccEEcccc //