[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57142.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.55.1
:363 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   66->320 1mwmA PDBj 2e-08 24.6 %
:RPS:PDB   142->320 3d2eA PDBj 1e-06 19.3 %
:RPS:SCOP  27->185 1mwkA1  c.55.1.1 * 2e-07 20.8 %
:RPS:SCOP  206->352 2fsjA1  c.55.1.12 * 1e-18 22.1 %
:HMM:SCOP  25->187 1mwmA1 c.55.1.1 * 1.5e-33 40.5 %
:HMM:SCOP  199->355 2fsjA1 c.55.1.12 * 2.5e-25 32.3 %
:RPS:PFM   90->349 PF06406 * StbA 3e-22 34.3 %
:HMM:PFM   68->334 PF06406 * StbA 2.6e-21 26.5 249/318  
:BLT:SWISS 66->320 PARM_ECOLX 1e-07 24.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57142.1 GT:GENE ABA57142.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 671077..672168 GB:FROM 671077 GB:TO 672168 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57142.1 GB:DB_XREF GI:76882461 LENGTH 363 SQ:AASEQ MTELTDEKTTDQRQASIADDPMQVVQVGLDDGYAYTKVALPDGRLVSVPSRARMGAAGVTWIRDVEQRIFEYETAGTVYSVGAVDGEPTQFDEYPGSALNRVIVQHALQEAGLSGRSLHLVTGLPVAAFYRGDGQQRRQAIQTKRDGLKLTVEPVVAKKSSTRQALKASIAFHEVIPEALAAWYDFVIVTLDDGVTLDADRLNAPIAIVDIGGRTTDYVVVQDQGVVHGSSGSLNRGMLDLKLRVANLIQERFDLHELGEQIISRAVDTNRLRLHGKDHDVSDMVMNAKRELVERLYAETRRKLGLGVELDRILFVGGGSAALSSDIADWFPNQTIADHAAFANARGMLKYLQFVCDDASKER GT:EXON 1|1-363:0| BL:SWS:NREP 1 BL:SWS:REP 66->320|PARM_ECOLX|1e-07|24.8|234/320| BL:PDB:NREP 1 BL:PDB:REP 66->320|1mwmA|2e-08|24.6|232/316| RP:PDB:NREP 1 RP:PDB:REP 142->320|3d2eA|1e-06|19.3|176/622| RP:PFM:NREP 1 RP:PFM:REP 90->349|PF06406|3e-22|34.3|242/258|StbA| HM:PFM:NREP 1 HM:PFM:REP 68->334|PF06406|2.6e-21|26.5|249/318|StbA| RP:SCP:NREP 2 RP:SCP:REP 27->185|1mwkA1|2e-07|20.8|149/157|c.55.1.1| RP:SCP:REP 206->352|2fsjA1|1e-18|22.1|145/161|c.55.1.12| HM:SCP:REP 25->187|1mwmA1|1.5e-33|40.5|153/0|c.55.1.1|1/1|Actin-like ATPase domain| HM:SCP:REP 199->355|2fsjA1|2.5e-25|32.3|155/0|c.55.1.12|1/1|Actin-like ATPase domain| OP:NHOMO 18 OP:NHOMOORG 18 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------1-----------------------------1--1-----1----------------------1-1-------------------1--1-------1---1---------111----------------------------------------1--------------------------------------1-------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 324 STR:RPRED 89.3 SQ:SECSTR #######################cEEEEEEccccEEEEEEcccccEEEEccccccccccccccccccccccTHHHHHHcccccccccccccHHHHHHHHHHHHHHTTccccTHTTccEEEEEEEcTTccEEETTTEHHHHHHHHcccccEEEEEEcTTcHHHHHHHHHHHHHTTEEEHHHHHHHHHHHHHHHcccccccccccEEEEEEEEccccEEEEEEEETTEEEEEEEETTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEETTEEEEEEEEHHHHHHHTTTTHHHHHHHTccGGccEEEEEcGGGHHHHHHHHHHHTccEEccccTTHHHHH################ DISOP:02AL 1-15, 359-363| PSIPRED cccHHHHccccccccccccccEEEEEEEEEEcccEEEEEEEcccEEEccccccccccccccEEEcccEEEEEEcccEEEEcccccccccccccccccHHHHHHHHHHHHHHccccccEEEEEcccHHHHHccccHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEEEEEEEcccHHHHHHHHcccccccccccccccccEEEEEccccEEEEEEEEccEEEEcccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHccccEEcccHHHHHHHHHHHHHHHHHHHHHccc //