[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57143.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  50/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
:142 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   6->128 PF12101 * DUF3577 2e-37 57.7 %
:HMM:PFM   6->139 PF12101 * DUF3577 9.7e-56 51.5 134/138  
:BLT:SWISS 33->93 DNBI_SCMVC 9e-04 35.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57143.1 GT:GENE ABA57143.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 672358..672786 GB:FROM 672358 GB:TO 672786 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57143.1 GB:DB_XREF GI:76882462 LENGTH 142 SQ:AASEQ MTSRQTTAEKPKYFDLDIHGIGYLNRVREVTPENGFPFLSVTIAALRGPADNVQHTHFECVVVGEEAKDLVRQLTPAVEADLKVLVGFHLSDLQAETFIFKNGDRAGTTGISLKSRLLRFQWIKVDGQPFPAPTSEAHNAVA GT:EXON 1|1-142:0| BL:SWS:NREP 1 BL:SWS:REP 33->93|DNBI_SCMVC|9e-04|35.7|56/100| RP:PFM:NREP 1 RP:PFM:REP 6->128|PF12101|2e-37|57.7|123/138|DUF3577| HM:PFM:NREP 1 HM:PFM:REP 6->139|PF12101|9.7e-56|51.5|134/138|DUF3577| OP:NHOMO 60 OP:NHOMOORG 51 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------4-----------------------1---1--1---123-1-----1----------------1-11--------------------------------------------------------------1---------1--------------------1--1---------11-------------------1--------------21--1111--------11-1--2---------1--------1--------------------------11----11--------------111-111---11---1--------------------------1-211---1-------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-10, 107-108, 134-142| PSIPRED cccccccccccEEEEEEEEcEEEEcccEEEccccccEEEEEEEEEEEcccccccEEEEEEEEccHHHHHHHHHHHHHHHcccEEEEEEEEccEEEEEEEEEcccccccccccEEEEEEEEEEEEEccEEccccHHccccccc //