[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57147.1
DDBJ      :             PilL protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:164 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57147.1 GT:GENE ABA57147.1 GT:PRODUCT PilL protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 675757..676251 GB:FROM 675757 GB:TO 676251 GB:DIRECTION + GB:PRODUCT PilL protein GB:PROTEIN_ID ABA57147.1 GB:DB_XREF GI:76882466 LENGTH 164 SQ:AASEQ MSSSKHHPMSQLLRILLCCSAAAVTSHSAVAKERPVTAISTLTQIDRYSVIAVRPTAGQRDLLSVTRAITIPDDIESVGEAFHWMLRDSGYRLATDTVLSEESAAMLELPLPAVHRRFEPMPLQTVMGLMIGPAFHLIQDPVHRLIAFERCADSPDPNATGGAQ GT:EXON 1|1-164:0| SEG 20->31|saaavtshsava| OP:NHOMO 38 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------------1-------11-1------------------------1-----------------------------------------------------------------1----------------------------1--1---------11-----------------------------------1--11-1--------11-1--2---------1--------1-----------1212---------------------------------111--1----11------------------------------1-11------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 26-39, 155-164| PSIPRED ccccccccHHHHHHHHHHHHHccccccccccccccccccccEEEcccEEEEEccccHHHHHHHHcEEEEEccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHcccHHHHHHcccHHHHHHHHHHccccEEEEEcccccEEEEEEcccccccccccccc //