[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57160.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:76 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   1->75 PF11660 * DUF3262 4e-07 36.0 %
:HMM:PFM   1->75 PF11660 * DUF3262 9.8e-28 34.7 75/76  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57160.1 GT:GENE ABA57160.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 690445..690675 GB:FROM 690445 GB:TO 690675 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57160.1 GB:DB_XREF GI:76882479 LENGTH 76 SQ:AASEQ MTAAQQTAFQAGSGITPATMLTSIASMVLVLAFVWVIWVALGVFRAWQEGQATVFDLTWSTLRASIVLMVLGFYLR GT:EXON 1|1-76:0| TM:NTM 2 TM:REGION 22->44| TM:REGION 55->76| RP:PFM:NREP 1 RP:PFM:REP 1->75|PF11660|4e-07|36.0|75/76|DUF3262| HM:PFM:NREP 1 HM:PFM:REP 1->75|PF11660|9.8e-28|34.7|75/76|DUF3262| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED ccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHc //