[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57169.1
DDBJ      :             Protein of unknown function DUF1525
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:134 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   57->130 3dvxA PDBj 1e-04 13.5 %
:RPS:PFM   22->130 PF07511 * DUF1525 5e-12 38.0 %
:HMM:PFM   19->129 PF07511 * DUF1525 3.5e-39 40.0 110/114  
:BLT:SWISS 84->126 THIO_ARCFU 3e-04 37.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57169.1 GT:GENE ABA57169.1 GT:PRODUCT Protein of unknown function DUF1525 GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 698625..699029 GB:FROM 698625 GB:TO 699029 GB:DIRECTION + GB:PRODUCT Protein of unknown function DUF1525 GB:PROTEIN_ID ABA57169.1 GB:DB_XREF GI:76882488 InterPro:IPR011090 LENGTH 134 SQ:AASEQ MVLTSTLSAPAIAGEAAPAIEVFTDSTFQVVSASDNTTVYVMDRINQLLQVLSEDLPSDPENAKQLVLARFQRMDAQLSSELENAAKGLVQAMQYGINRYPAIVINGNAVVYGVTDVSAATQLYQRWQTRGARQ GT:EXON 1|1-134:0| BL:SWS:NREP 1 BL:SWS:REP 84->126|THIO_ARCFU|3e-04|37.2|43/100| SEG 9->21|apaiageaapaie| RP:PDB:NREP 1 RP:PDB:REP 57->130|3dvxA|1e-04|13.5|74/187| RP:PFM:NREP 1 RP:PFM:REP 22->130|PF07511|5e-12|38.0|108/114|DUF1525| HM:PFM:NREP 1 HM:PFM:REP 19->129|PF07511|3.5e-39|40.0|110/114|DUF1525| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------1-------1--------------------------------------------------------------------------------------------------------------------------1--1------------------------------1-------------------------------------------------------1--------------------------------1-------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 83.6 SQ:SECSTR ######################ccHHHHHHHHHHHHHHHHHHHHHHHHHTTcccTTTTcHHHHHHHHHHcccccHHHHHHHHcHHHHHHHHHHHHTcccccEEEETTTEEEccTTHHHHHHHHHHHHHHHTHHH DISOP:02AL 55-61, 68-81, 130-134| PSIPRED cHHHHHHHHHHccccccccEEEEEccccccEEcccccEEEEEccHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccEEEEccccHHHHHHHHHHHHHHHccc //