[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57177.1
DDBJ      :             putative transposase gene of IS630 family insertion sequence ISY100h
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  81/915 : Eukaryota  11/199 : Viruses  0/175   --->[See Alignment]
:165 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   95->159 3f2kA PDBj 5e-04 30.8 %
:HMM:PFM   76->135 PF03184 * DDE 2e-05 23.3 60/217  
:BLT:SWISS 104->165 TC3A_CAEEL 2e-04 34.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57177.1 GT:GENE ABA57177.1 GT:PRODUCT putative transposase gene of IS630 family insertion sequence ISY100h GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 711940..712437 GB:FROM 711940 GB:TO 712437 GB:DIRECTION + GB:PRODUCT putative transposase gene of IS630 family insertion sequence ISY100h GB:PROTEIN_ID ABA57177.1 GB:DB_XREF GI:76882496 LENGTH 165 SQ:AASEQ MKRKSFLRLRERYRRRGKRFVYLDESGFEPEVSRRYAYAPKGRRVYGLISGHRRPRTSLLAARMDEGFEAPFLFEGTCNTAVFNAWLEKELCPLLNSNHIVIMDNAPFHKAVSSREIIKKTGAGILFLPPYSPDFNPIEKDFGNIKKIREYNEHETLENIVAAYQ GT:EXON 1|1-165:0| BL:SWS:NREP 1 BL:SWS:REP 104->165|TC3A_CAEEL|2e-04|34.4|61/100| SEG 3->20|rksflrlreryrrrgkrf| BL:PDB:NREP 1 BL:PDB:REP 95->159|3f2kA|5e-04|30.8|65/195| HM:PFM:NREP 1 HM:PFM:REP 76->135|PF03184|2e-05|23.3|60/217|DDE| OP:NHOMO 758 OP:NHOMOORG 92 OP:PATTERN -------------------------------------------------------------------- ----------------------------------------------------------------------------------------------------------------------------3--------3-----1------I45B15UD----------R-3-3-9------------1---------------------------------------------------------------------------------------------------------74111-2-311--------------34---444--------------------------------------------------2---8--------4----4S-----2----------B-3111-F11----1---5-7--17D2----4--------1--------253--1------------2R------1---------3--1-1---------------------------------------------8---7---------16---1-17-1----------------------------------------------------------------------------------------------I----------------------------------------------------------------------------------------------Q--------------------------------------2-E-------------------kv-c-muk---------------------------------------------------------------------------------------- -------------------------31-------------------1---2--------------------------------------3-----------91--6----1-----------------------------------------------------------------------------------1--1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 43.0 SQ:SECSTR ########################################################################################HHHHHHcccccEEEccccHHHHcTTHHHHHHHHTcEEccccTTcGGGcHHHHHHHHHHTTcccccHHHHHH###### DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHccccEEEEEcccEEEccccccEEEEEcccEEEEEEccccccEEEEEEEEEcccEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHccccccHHHHHHHHc //