[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57199.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.3
:110 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->98 2p1jB PDBj 2e-04 26.6 %
:RPS:PDB   15->103 3cm5A PDBj 2e-08 20.2 %
:RPS:SCOP  15->98 1j9aA  c.55.3.5 * 5e-07 17.1 %
:HMM:SCOP  9->100 1y97A1 c.55.3.5 * 3.6e-12 27.8 %
:RPS:PFM   19->97 PF00929 * Exonuc_X-T 7e-06 34.6 %
:HMM:PFM   18->103 PF00929 * Exonuc_X-T 1.1e-09 25.0 84/165  
:BLT:SWISS 15->97 DPO3E_PASMU 2e-04 28.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57199.1 GT:GENE ABA57199.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 736290..736622 GB:FROM 736290 GB:TO 736622 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57199.1 GB:DB_XREF GI:76882518 LENGTH 110 SQ:AASEQ MAMYNELLWIFTQLPDDYVVLDTETTGLPEENGLPDIVTLGLTAVKNREISESVEFETRLQRRILEEAQSIHGITNIQTARFESFDSRWHQITDYLKDERSTHRHSQCQF GT:EXON 1|1-110:0| BL:SWS:NREP 1 BL:SWS:REP 15->97|DPO3E_PASMU|2e-04|28.9|83/253| BL:PDB:NREP 1 BL:PDB:REP 18->98|2p1jB|2e-04|26.6|79/171| RP:PDB:NREP 1 RP:PDB:REP 15->103|3cm5A|2e-08|20.2|89/294| RP:PFM:NREP 1 RP:PFM:REP 19->97|PF00929|7e-06|34.6|78/163|Exonuc_X-T| HM:PFM:NREP 1 HM:PFM:REP 18->103|PF00929|1.1e-09|25.0|84/165|Exonuc_X-T| RP:SCP:NREP 1 RP:SCP:REP 15->98|1j9aA|5e-07|17.1|82/184|c.55.3.5| HM:SCP:REP 9->100|1y97A1|3.6e-12|27.8|90/0|c.55.3.5|1/1|Ribonuclease H-like| OP:NHOMO 2 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 93 STR:RPRED 84.5 SQ:SECSTR ############ccccEEEEEEEEEcccTcccccccEEEEEEEEETTTEEEEEEEEEEEEEccccHHHHHHHcccHHHHHTcEEHHHHHHHHHHHHHHTTccTHH##### DISOP:02AL 1-3| PSIPRED ccHHHHHHHHHHHccccEEEEEEEcccccccccccEEEEEEEEEEccEEEccEEEEEEcccccccHHHEEEccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccc //