[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57201.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:100 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   28->98 PF09686 * Plasmid_RAQPRD 4e-08 46.5 %
:HMM:PFM   20->98 PF09686 * Plasmid_RAQPRD 3.4e-27 46.8 79/81  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57201.1 GT:GENE ABA57201.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 740989..741291 GB:FROM 740989 GB:TO 741291 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57201.1 GB:DB_XREF GI:76882520 LENGTH 100 SQ:AASEQ MKRQFWPLTFLILALSVAPAAFADADAEREVLAKIIHELNALDPLIKRTEANADQDSHIRLRYDWLHQDLKQIRDGIQSHINFPRAQPRSFLPLRGDYRR GT:EXON 1|1-100:0| SEG 18->27|apaafadada| RP:PFM:NREP 1 RP:PFM:REP 28->98|PF09686|4e-08|46.5|71/81|Plasmid_RAQPRD| HM:PFM:NREP 1 HM:PFM:REP 20->98|PF09686|3.4e-27|46.8|79/81|Plasmid_RAQPRD| OP:NHOMO 3 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------2----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEcHHHHHHHHHHHHHHHHHHcccccccccccccccccccc //