[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57209.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.122.1
:138 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->99 1wmmA1  b.122.1.8 * 7e-05 20.7 %
:HMM:PFM   20->71 PF01878 * DUF55 0.00033 23.1 52/143  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57209.1 GT:GENE ABA57209.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 751065..751481 GB:FROM 751065 GB:TO 751481 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:PROTEIN_ID ABA57209.1 GB:DB_XREF GI:76882528 LENGTH 138 SQ:AASEQ MKTWLVNTNIRPENGNPNAFKYMLRQNKAAAFYGRAVEIDNICRGDLVCLYHNDNRIIAVGAVVEPYQGHDFEEMELIEHWVDVNWLWKADFNDSFEPLNSIDRRELGIKMVNGTVINITDQVNYKELLTQIAQRPIF GT:EXON 1|1-138:0| HM:PFM:NREP 1 HM:PFM:REP 20->71|PF01878|0.00033|23.1|52/143|DUF55| RP:SCP:NREP 1 RP:SCP:REP 1->99|1wmmA1|7e-05|20.7|92/143|b.122.1.8| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 137-138| PSIPRED ccEEEEEccccccccccHHHHHHHHcccccEEEcccccccccccccEEEEEEcccEEEEEccEEcccccccHHHHHHHHHHcccEEEEEccccccccccccccccccEEEEEccEEEEEEccccHHHHHHHHHccccc //