Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57240.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:263 amino acids
:REPEAT 2|27->129|151->252

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57240.1 GT:GENE ABA57240.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 786753..787544 GB:FROM 786753 GB:TO 787544 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57240.1 GB:DB_XREF GI:76882559 LENGTH 263 SQ:AASEQ MQQRYNSFVLLFCLSFMGLGFAQDQGEEAALKDRASVFWKARVQEDWATVYNFLPSETRSKTAKEQFVAFRQKKGPFRYLSSEIGKVAVAGDKGWVELHYTAQPYNYPEISPDRIEMWEPWQIREKQWYPVPPQLREQMPKLPPHLRPAEEEAALSRRADEFWKAKEAQNWDLIYRFLEPSYRAEVSKAEFLSKQSLFVYVTHRFEWVEVRGNQGRVNVVYSRKLNDPTLYKLQPEEDSMIAEWVKVDGVWYRHVELPSGGES GT:EXON 1|1-263:0| NREPEAT 1 REPEAT 2|27->129|151->252| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 142-148, 259-263| PSIPRED cccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccEEEEEEEEcEEEEEccEEEEEEEEEccccccccccccEEEEEcccHHHHHcccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHccccEEEEcHHHHHccccEEEEEEEEEEEEEEEcccEEEEEEEEccccccEEEEccccccccEEEEEEEccEEEEEEEccccccc //