[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57254.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:300 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->256 2zq5A PDBj 2e-04 32.6 %
:RPS:PDB   61->263 1cjmA PDBj 3e-08 17.0 %
:HMM:SCOP  1->267 1aquA_ c.37.1.5 * 1.3e-22 26.2 %
:HMM:PFM   3->277 PF00685 * Sulfotransfer_1 1.2e-09 21.5 191/257  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57254.1 GT:GENE ABA57254.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 803337..804239 GB:FROM 803337 GB:TO 804239 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57254.1 GB:DB_XREF GI:76882573 LENGTH 300 SQ:AASEQ MKLFMQGLRRSGTTIVYDVLSQDRRLDLYYEPFAAGKIGELGGGSGVQETDFMVKHCQVKQAFIASYPESVDMVDLNHGAPRAPILELQRELPQFCRDYIRFMVERREHSVIKFTRMYRKVGELAALAPQARFVLLVRHPQQVVASYLYGRGQRRLGQLASREQFFTIRDQFNAWKFREFFEGIIAQQGRPELADAPNWIRCLVLWKYTFDNAYQDGRAAFGDAFRVLRHEDLCAHPRNTVTQLYRHMGLSVSGEAVTWAEAHVRENDKACYQDDPRWLEAYERLDLVDSLIAAGYGPCQ GT:EXON 1|1-300:0| BL:PDB:NREP 1 BL:PDB:REP 3->256|2zq5A|2e-04|32.6|221/365| RP:PDB:NREP 1 RP:PDB:REP 61->263|1cjmA|3e-08|17.0|165/223| HM:PFM:NREP 1 HM:PFM:REP 3->277|PF00685|1.2e-09|21.5|191/257|Sulfotransfer_1| HM:SCP:REP 1->267|1aquA_|1.3e-22|26.2|187/0|c.37.1.5|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 289 STR:RPRED 96.3 SQ:SECSTR ##EEEEccTTccHHHHHHHHTTcTTHHHcccccccGGGGGGcHHHHHHHHTTHHHTcccccEEEEEcTTcHHHHHHHHccTccccTTccTcccTTcccTTTTcccccEEEccEEEcccGGGccHHHHHTTcEEEEEEccHHHHHHHHHHHHHHHHHcccccHTHHHHcTTccccccHHHHHHH##HHHHTTccTTccHHHTTccTTccHHHHHHHHHHHTTTccEEEEEHHHHHHcHHHHHHHHHHHHTcccccGGGTccHHHTTTEHHHcTTTccTTccTTTcHHHHHHHHH####### DISOP:02AL 3-7| PSIPRED ccHHHHHHHccccEEEEHHHcccccEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHHHHccccccccccccHHHHHHHHHHccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccccc //