[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57262.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:339 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   129->285 2ad1A PDBj 4e-05 21.0 %
:HMM:SCOP  3->281 1fmjA_ c.37.1.5 * 7.5e-20 23.6 %
:HMM:PFM   7->152 PF00685 * Sulfotransfer_1 0.00013 15.7 108/257  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57262.1 GT:GENE ABA57262.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 815951..816970 GB:FROM 815951 GB:TO 816970 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57262.1 GB:DB_XREF GI:76882581 LENGTH 339 SQ:AASEQ MSRQAPLFITARFRSGSTLLWHIFDQARGYHAYYEPCHDNLLAHIRHTLPMDSHQGVQSYWDAYQNQLPLMESGHQPEFGLSRLLLEAHESWDELKHYLQSLVQGAAPAIPVLQFNRIDFRLPWIRTHFPQARIIHLHRDSRDSYFSMARHLEPEAADNPEQGHVYDLLEWSVALAECFPFLAEPGIQSLYERHYYFWKLSYLMGRRCSDLSLSYDADFRDNPSLGLEKLSQAGYLDSQQIDDLHPLIQSQASGQWAERYSESWFQTIEDRCEQVLDELGLNAHFGFFPLVEIKKRYAAWSRYEGLPLNDPARGLLMEYSRQRSEITRLLSLVRNASKD GT:EXON 1|1-339:0| RP:PDB:NREP 1 RP:PDB:REP 129->285|2ad1A|4e-05|21.0|138/244| HM:PFM:NREP 1 HM:PFM:REP 7->152|PF00685|0.00013|15.7|108/257|Sulfotransfer_1| HM:SCP:REP 3->281|1fmjA_|7.5e-20|23.6|229/0|c.37.1.5|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------1----1------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 40.7 SQ:SECSTR ################################################################################################################################HTTcEEEEEEccHHHHHHHHHHHcTTccccccH#############HHHHHHHHTTcccTccHHHHHHHHHHHTTTccE###EEEEHH#HHHHcHHHHHHHHHH##HTTccccTTHHHHHHHHcccGGGGTccHHHHHHHHHHHHHHcccTTccccc###################################################### DISOP:02AL 1-4, 154-158, 336-339| PSIPRED ccccccEEEEEccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHccccccccHHHHHHcccccHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHccHHEEEEEEEccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccc //