[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57267.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:466 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57267.1 GT:GENE ABA57267.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(820169..821569) GB:FROM 820169 GB:TO 821569 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57267.1 GB:DB_XREF GI:76882586 InterPro:IPR001005 LENGTH 466 SQ:AASEQ MILFQLLTALFLPWLLGVAWLRIGWPRTARGAGPLVLGYAYLLGTLATTFMMRLWDGIGLKQAFWPLAGLLLALTLLGFWVSRTKTRKDDGYVDNSAVHSWNSWQTGLFALLIALLAIRFVNLGLEILWRPLYPWDAWTTWAPRAQVWFALKELVPFVDSATWLHHPSRDIYTLPAWSYPETVSLIQLWISLALEQWDDSLINLPWLFCAAALGLAFYGQLRLWGLVPLASLLGTYLLLSLPLLNIHTALAGYADLWLAATYSLAGMAFLQWLRNGDPWQGGLALLLALACPFIKREGLIWMLTFLPPLLIACLPCRTRLLAGAGGVALLAIWYVSGGIRIGEFQLTPEVIQIPSLGHFEISLQGGWEPFQQNLLVLDNWHLLWYLAIPAMALSIPLMIARRQRLIGLTFIGSGLVVIFGTFFLTDNAAWAESYTSINRILLHWVPLLLFYVLVLLQACMLEPRRD GT:EXON 1|1-466:0| TM:NTM 14 TM:REGION 2->24| TM:REGION 30->52| TM:REGION 60->81| TM:REGION 107->129| TM:REGION 176->198| TM:REGION 200->222| TM:REGION 225->247| TM:REGION 251->272| TM:REGION 274->294| TM:REGION 297->317| TM:REGION 319->341| TM:REGION 379->400| TM:REGION 406->427| TM:REGION 438->460| SEG 67->78|laglllaltllg| SEG 108->118|lfalliallai| SEG 229->244|lasllgtylllslpll| SEG 283->290|lalllala| SEG 320->331|llagaggvalla| SEG 445->456|vplllfyvlvll| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 464-466| PSIPRED cHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHcHHHHEEcccccccccccccHHHHHHHHHHHHHHHcccHHHccccccEEEcccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccEEEEEEEcHHHHcccccccEEEEEcccccHHHccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHEEHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc //