[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57293.1
DDBJ      :             Isochorismatase hydrolase
Swiss-Prot:             

Homologs  Archaea  19/68 : Bacteria  174/915 : Eukaryota  53/199 : Viruses  0/175   --->[See Alignment]
c.33.1
:243 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   82->234 1nbaB PDBj 2e-12 28.8 %
:RPS:PDB   38->227 3eefA PDBj 6e-25 20.5 %
:RPS:SCOP  14->234 1nf8A  c.33.1.3 * 5e-36 23.6 %
:HMM:SCOP  33->237 1nbaA_ c.33.1.3 * 1.5e-45 38.0 %
:RPS:PFM   82->231 PF00857 * Isochorismatase 6e-24 40.5 %
:HMM:PFM   81->232 PF00857 * Isochorismatase 1.4e-35 33.1 151/174  
:BLT:SWISS 32->237 YWOC_BACSU 3e-12 33.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57293.1 GT:GENE ABA57293.1 GT:PRODUCT Isochorismatase hydrolase GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION complement(853120..853851) GB:FROM 853120 GB:TO 853851 GB:DIRECTION - GB:PRODUCT Isochorismatase hydrolase GB:PROTEIN_ID ABA57293.1 GB:DB_XREF GI:76882612 InterPro:IPR000868 LENGTH 243 SQ:AASEQ MTHSNAPLKESFDPLRASYRETVTEIPAVVESLEKRHTALLVVDLQYLDAAPGYGVFSHLSKGKVSKDTPEFYYFDQLERIVLPNVQRLQTAFRANNLEVIHTRIQSLTKDGRDRGPQHKRLGLHAPAGSKEAEFLPAIAPRGDEIIINKTASGVFNATNLSYILHNLGITGLFVAGVYTNECVSTAIRDACDLGFFTTLIEDACTTVTPELQKATLRALKDRYARVLSTDEAIAEINQVVAA GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 32->237|YWOC_BACSU|3e-12|33.9|177/189| BL:PDB:NREP 1 BL:PDB:REP 82->234|1nbaB|2e-12|28.8|153/252| RP:PDB:NREP 1 RP:PDB:REP 38->227|3eefA|6e-25|20.5|161/168| RP:PFM:NREP 1 RP:PFM:REP 82->231|PF00857|6e-24|40.5|148/173|Isochorismatase| HM:PFM:NREP 1 HM:PFM:REP 81->232|PF00857|1.4e-35|33.1|151/174|Isochorismatase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00857|IPR000868| GO:PFM GO:0008152|"GO:metabolic process"|PF00857|IPR000868| RP:SCP:NREP 1 RP:SCP:REP 14->234|1nf8A|5e-36|23.6|199/207|c.33.1.3| HM:SCP:REP 33->237|1nbaA_|1.5e-45|38.0|187/253|c.33.1.3|1/1|Isochorismatase-like hydrolases| OP:NHOMO 379 OP:NHOMOORG 246 OP:PATTERN ---11---11111111------------1--1-----------2---2---111-------1-2---- 1-1-2---------1----------1------11-1--2--1-------11-------------1-1---------------1------------------1--------------------------------------1----1-------12-------------------------------1111-1-1444443121333223-----1231--------------1-------------------------------------------------------------------------------------------1---------------------------------1----------------1---------1-333----1-2-----------1-2212-12--6--4222222232331--1--------1-1---------11----1-------------------------------11--1222--1112------1121-----2--2222-----112---2--122-----1------------------1---1----11----1---1-1-----2--1---------------------------------------1-------------------1--1-------1----11111111111-111111111111111111-------------------------3------1---------------------------1-1-----------------------1---1-3333134322322-443-----------------------------------------------------------------------------------------------1- -----1----------11-121212-11111111111121111111121---1-11----------------------------------1-1---------------3------------------------------------------------------2------------2--3---211---2-12121122 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 211 STR:RPRED 86.8 SQ:SECSTR #####################cGGGcccccccccTccEEEEEEccHTTcccccccc#####HHHTcTTccHHTTHHHHHHHHHHHHHHHHHHHHHTTccEEEEEEccTTcEcccTTcTTHHHHccccTTcGGGcccGGGcccTTcEEEEEccccTTTTccHHHHHHHTTccEEEEEEEcTTTHHHHHHHHHHHTTcEEEEEEEEEEccccTTHHHHHHHHHccEEEcccTTcEEccc###### DISOP:02AL 1-26, 242-243| PSIPRED ccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccccccccccccccHHHHHHHcccccEEEEcccccccccccHHHHHHHccccEEEEEEccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHHcccEEEcHHHHHHHHHHHHcc //