[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nitrosococcus oceani ATCC 19707 (noce0)
Gene : ABA57297.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:252 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   192->245 PF03154 * Atrophin-1 3e-04 35.2 %
:HMM:PFM   115->180 PF01152 * Bac_globin 0.00012 33.3 66/120  
:HMM:PFM   156->229 PF00261 * Tropomyosin 0.00094 25.7 74/237  
:TM
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID ABA57297.1 GT:GENE ABA57297.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00281CH01 GT:ORG noce0 GB:ACCESSION GIB00281CH01 GB:LOCATION 857324..858082 GB:FROM 857324 GB:TO 858082 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID ABA57297.1 GB:DB_XREF GI:76882616 LENGTH 252 SQ:AASEQ MRALMGYGAVLGVGWAMLALFLLGGCTGLKPGSPIPVYELSSPAYKLSVPSPNSLEPEPGDSELLLQYYRGLHALSEAELQRELEQAWQTTAKEPTAFDRLQLILLLSLPEVPFQDLEQARAMLRSFLKTELEGAKEYEGAKGLYDLALFLQGFLMEEAQQKRRYRLLQEQLEQKQEQVKRLRSGLKYLDGRRKQEQEWAHSLEQQLENERGRAETLEQKLEALKTIEKRLEYRNQSQENLQLPEQKNESND GT:EXON 1|1-252:0| COIL:NAA 68 COIL:NSEG 2 COIL:REGION 159->187| COIL:REGION 194->232| TM:NTM 1 TM:REGION 4->26| SEG 160->182|qqkrryrllqeqleqkqeqvkrl| RP:PFM:NREP 1 RP:PFM:REP 192->245|PF03154|3e-04|35.2|54/648|Atrophin-1| HM:PFM:NREP 2 HM:PFM:REP 115->180|PF01152|0.00012|33.3|66/120|Bac_globin| HM:PFM:REP 156->229|PF00261|0.00094|25.7|74/237|Tropomyosin| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 50-59, 168-183, 196-216, 232-252| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEcccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccHHHcccccccccccc //